Gene/Proteome Database (LMPD)
Proteins
membrane progestin receptor beta | |
---|---|
Refseq ID | NP_083105 |
Protein GI | 40254346 |
UniProt ID | Q80ZE5 |
mRNA ID | NM_028829 |
Length | 354 |
RefSeq Status | PROVISIONAL |
MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRHEIFLQRHGPLSVYSACLSFFVLAACSAATATLLRHKVKDRLIKKDS |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member VIII
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IBA:RefGenome | C | plasma membrane |
GO:0005496 | IBA:RefGenome | F | steroid binding |
GO:0003707 | IBA:RefGenome | F | steroid hormone receptor activity |
GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
GO:0048477 | IEA:UniProtKB-KW | P | oogenesis |
GO:0048545 | IBA:RefGenome | P | response to steroid hormone |
GO:0043401 | IBA:GOC | P | steroid hormone mediated signaling pathway |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member VIII
Protein Entry
MPRB_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation. {ECO:0000269|PubMed:12601167}. |
Sequence Caution | Sequence=BAC27629.1; Type=Frameshift; Positions=324; Evidence={ECO:0000305}; |
Similarity | Belongs to the ADIPOR family. {ECO:0000305}. |
Subcellular Location | Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Tissue Specificity | Expressed in brain and testis. {ECO:0000269|PubMed:11676489}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000227 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
40254346 | RefSeq | NP_083105 | 354 | membrane progestin receptor beta |
Identical Sequences to LMP000227 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40254346 | DBBJ | BAC26609.1 | 354 | unnamed protein product [Mus musculus] |
GI:40254346 | DBBJ | BAE27872.1 | 354 | unnamed protein product [Mus musculus] |
GI:40254346 | GenBank | AAH59813.1 | 354 | Progestin and adipoQ receptor family member VIII [Mus musculus] |
GI:40254346 | RefSeq | XP_006495640.1 | 354 | PREDICTED: membrane progestin receptor beta isoform X1 [Mus musculus] |
GI:40254346 | RefSeq | XP_006495641.1 | 354 | PREDICTED: membrane progestin receptor beta isoform X2 [Mus musculus] |
GI:40254346 | SwissProt | Q80ZE5.2 | 354 | RecName: Full=Membrane progestin receptor beta; Short=mPR beta; AltName: Full=Progestin and adipoQ receptor family member VIII [Mus musculus] |
Related Sequences to LMP000227 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40254346 | DBBJ | BAC33221.1 | 354 | unnamed protein product [Mus musculus] |
GI:40254346 | GenBank | AAO47230.1 | 354 | putative membrane steroid receptor [Mus musculus] |
GI:40254346 | GenBank | AAR08385.1 | 354 | progestin and adipoQ receptor family member VIII [Mus musculus] |
GI:40254346 | GenBank | EDL14384.1 | 354 | progestin and adipoQ receptor family member VIII [Mus musculus] |
GI:40254346 | GenBank | EDM18645.1 | 354 | similar to putative membrane steroid receptor, isoform CRA_a [Rattus norvegicus] |
GI:40254346 | RefSeq | NP_001014121.1 | 354 | membrane progestin receptor beta [Rattus norvegicus] |