Gene/Proteome Database (LMPD)
LMPD ID
LMP000318
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinol dehydrogenase 16 (all-trans)
Gene Symbol
Synonyms
RODH-4; SDR9C8
Alternate Names
retinol dehydrogenase 16; sterol/retinol dehydrogenase; retinol dehydrogenase 16 (all-trans and 13-cis); microsomal NAD+-dependent retinol dehydrogenase 4; microsomal NAD(+)-dependent retinol dehydrogenase 4; short chain dehydrogenase/reductase family 9C, member 8
Chromosome
12
Map Location
12q13.3
EC Number
1.1.-.-
Proteins
| retinol dehydrogenase 16 | |
|---|---|
| Refseq ID | NP_003699 |
| Protein GI | 150247226 |
| UniProt ID | O75452 |
| mRNA ID | NM_003708 |
| Length | 317 |
| RefSeq Status | VALIDATED |
| MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL | |
Gene Information
Entrez Gene ID
Gene Name
retinol dehydrogenase 16 (all-trans)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043231 | TAS:ProtInc | C | intracellular membrane-bounded organelle |
| GO:0009055 | TAS:UniProtKB | F | electron carrier activity |
| GO:0004745 | TAS:ProtInc | F | retinol dehydrogenase activity |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_160156 | The canonical retinoid cycle in rods (twilight vision) |
| REACT_160125 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinol dehydrogenase 16 (all-trans)
Protein Entry
RDH16_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=0.14 uM for androsterone ; KM=0.22 uM for androstanediol ; KM=0.80 uM for dihydrotestosterone ; KM=0.13 uM for NAD ; KM=190 uM for NADP ; |
| Enzyme Regulation | Inhibited by citral, perillyl alcohol, geraniol, farnesol and geranyl geraniol. |
| Function | Oxidoreductase with a preference for NAD. Oxidizes all- trans-retinol and 13-cis-retinol to the corresponding aldehydes. Has higher activity towards CRBP-bound retinol than with free retinol. Oxidizes 3-alpha-hydroxysteroids. Oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. Can also catalyze the reverse reaction. {ECO |
| Induction | Transiently up-regulated by retinoic acid. |
| Ptm | Not N-glycosylated. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Microsome membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane ; Single-pass type IV membrane protein . |
| Tissue Specificity | Highly expressed in adult liver (at protein level). Detected in endometrium, liver and foreskin. Detected in the spineous layers of adult skin, and at lower levels in basal and granular skin layers. Detected in fetal liver and lung. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000318 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 150247226 | RefSeq | NP_003699 | 317 | retinol dehydrogenase 16 |
Identical Sequences to LMP000318 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:150247226 | GenBank | EAW96968.1 | 317 | retinol dehydrogenase 16 (all-trans and 13-cis) [Homo sapiens] |
| GI:150247226 | GenBank | AAI60081.1 | 317 | Retinol dehydrogenase 16 (all-trans) [synthetic construct] |
| GI:150247226 | SwissProt | O75452.2 | 317 | RecName: Full=Retinol dehydrogenase 16; AltName: Full=Microsomal NAD(+)-dependent retinol dehydrogenase 4; Short=RoDH-4; AltName: Full=Sterol/retinol dehydrogenase [Homo sapiens] |
Related Sequences to LMP000318 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:150247226 | GenBank | AAC39922.1 | 317 | sterol/retinol dehydrogenase [Homo sapiens] |
| GI:150247226 | GenBank | AAC72923.1 | 317 | retinol dehydrogenase [Homo sapiens] |
| GI:150247226 | GenBank | AHE01348.1 | 317 | Sequence 56264 from patent US 8586006 |
| GI:150247226 | RefSeq | XP_522604.1 | 317 | PREDICTED: retinol dehydrogenase 16 [Pan troglodytes] |
| GI:150247226 | RefSeq | XP_003824948.1 | 317 | PREDICTED: retinol dehydrogenase 16 [Pan paniscus] |
| GI:150247226 | RefSeq | XP_004053441.1 | 317 | PREDICTED: retinol dehydrogenase 16-like [Gorilla gorilla gorilla] |