Gene/Proteome Database (LMPD)

LMPD ID
LMP000349
Gene ID
8856
Species
Homo sapiens (Human)
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
NR1I2
Synonyms
BXR; ONR1; PAR; PAR1; PAR2; PARq; PRR; PXR; SAR; SXR
Chromosome
3
Map Location
3q12-q13.3
Summary
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for NR1I2

Proteins

nuclear receptor subfamily 1 group I member 2 isoform 1
Refseq ID NP_003880
Protein GI 34398348
UniProt ID O75469
mRNA ID NM_003889
Length 434
RefSeq Status REVIEWED
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
nuclear receptor subfamily 1 group I member 2 isoform 2
Refseq ID NP_071285
Protein GI 11863132
UniProt ID O75469
mRNA ID NM_022002
Length 473
RefSeq Status REVIEWED
MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
nuclear receptor subfamily 1 group I member 2 isoform 3
Refseq ID NP_148934
Protein GI 14702164
UniProt ID O75469
mRNA ID NM_033013
Length 397
RefSeq Status REVIEWED
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Gene Information

Entrez Gene ID
8856
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
NR1I2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005654 TAS:Reactome C nucleoplasm
GO:0000977 IDA:NTNU_SB F RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001228 IDA:NTNU_SB F RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0008144 IDA:UniProtKB F drug binding
GO:0004879 IDA:UniProtKB F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0003713 TAS:ProtInc F transcription coactivator activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0046618 IDA:UniProtKB P drug export
GO:0042738 IDA:UniProtKB P exogenous drug catabolic process
GO:0010467 TAS:Reactome P gene expression
GO:0030522 IDA:GOC P intracellular receptor signaling pathway
GO:0045892 IDA:MGI P negative regulation of transcription, DNA-templated
GO:0045944 IDA:NTNU_SB P positive regulation of transcription from RNA polymerase II promoter
GO:0045893 IDA:UniProtKB P positive regulation of transcription, DNA-templated
GO:0007165 TAS:ProtInc P signal transduction
GO:0008202 TAS:ProtInc P steroid metabolic process
GO:0006367 TAS:Reactome P transcription initiation from RNA polymerase II promoter
GO:0006805 IDA:UniProtKB P xenobiotic metabolic process
GO:0042908 IDA:UniProtKB P xenobiotic transport

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_15525 Nuclear Receptor transcription pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 1, group I, member 2
Protein Entry
NR1I2_HUMAN
UniProt ID
O75469
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=7; Name=1A; Synonyms=1, PRR1-A; IsoId=O75469-1; Sequence=Displayed; Name=1B; Synonyms=PRR1-B; IsoId=O75469-2; Sequence=VSP_003668; Name=1C; Synonyms=PRR1-C; IsoId=O75469-3; Sequence=VSP_003667; Name=2A; Synonyms=2, PRR2-A; IsoId=O75469-4; Sequence=VSP_003669; Name=2B; Synonyms=PRR2-B; IsoId=O75469-5; Sequence=VSP_003668, VSP_003669; Name=2C; Synonyms=PRR2-C; IsoId=O75469-6; Sequence=VSP_003667, VSP_003669; Name=3; IsoId=O75469-7; Sequence=VSP_026669;
Function Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. {ECO
Interaction P08238:HSP90AB1; NbExp=2; IntAct=EBI-3905991, EBI-352572;
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily.
Similarity Contains 1 nuclear receptor DNA-binding domain.
Subcellular Location Nucleus {ECO
Subunit Heterodimer with RXR. Interacts with NCOA1. {ECO
Tissue Specificity Expressed in liver, colon and small intestine.
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/nr1i2/";

Identical and Related Proteins

Unique RefSeq proteins for LMP000349 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
34398348 RefSeq NP_003880 434 nuclear receptor subfamily 1 group I member 2 isoform 1
11863132 RefSeq NP_071285 473 nuclear receptor subfamily 1 group I member 2 isoform 2
14702164 RefSeq NP_148934 397 nuclear receptor subfamily 1 group I member 2 isoform 3

Identical Sequences to LMP000349 proteins

Reference Database Accession Length Protein Name
GI:11863132 DBBJ BAI46174.1 473 nuclear receptor subfamily 1, group I, member 2, partial [synthetic construct]
GI:14702164 GenBank AAK38721.1 397 orphan nuclear receptor PXR.2 [Homo sapiens]
GI:34398348 GenBank ABJ52965.1 434 orphan nuclear receptor [Homo sapiens]
GI:14702164 GenBank ABJ52966.1 397 orphan nuclear receptor [Homo sapiens]
GI:34398348 GenBank ABL12766.1 434 Sequence 2 from patent US 7118885
GI:11863132 GenBank ABL12767.1 473 Sequence 4 from patent US 7118885
GI:11863132 GenBank EAW79538.1 473 nuclear receptor subfamily 1, group I, member 2, isoform CRA_b [Homo sapiens]
GI:11863132 GenBank ABR09276.1 473 nuclear receptor subfamily 1, group I, member 2 [Homo sapiens]
GI:11863132 GenBank ADZ17348.1 473 pregnane X nuclear receptor variant 2 [Homo sapiens]
GI:34398348 GenBank AEK13588.1 434 Sequence 2 from patent US 7972782
GI:34398348 GenBank AER79658.1 434 Sequence 1 from patent US 8048663
GI:34398348 GenBank AEW40333.1 434 Sequence 203 from patent US 8071291
GI:14702164 GenBank AEW40334.1 397 Sequence 204 from patent US 8071291
GI:34398348 GenBank AHD78572.1 434 Sequence 26570 from patent US 8586006
GI:11863132 GenBank AHD78573.1 473 Sequence 26571 from patent US 8586006
GI:14702164 GenBank AHD78574.1 397 Sequence 26572 from patent US 8586006

Related Sequences to LMP000349 proteins

Reference Database Accession Length Protein Name
GI:34398348 DBBJ BAI46174.1 473 nuclear receptor subfamily 1, group I, member 2, partial [synthetic construct]
GI:14702164 EMBL CAB55492.1 397 nuclear hormone receptor PRR2-A [Homo sapiens]
GI:14702164 EMBL CAB55493.1 420 nuclear hormone receptor PRR2-C [Homo sapiens]
GI:34398348 GenBank AAC64557.1 473 orphan nuclear receptor [Homo sapiens]
GI:34398348 GenBank AAK38722.1 473 orphan nuclear receptor PAR2 [Homo sapiens]
GI:14702164 GenBank EAW79539.1 397 nuclear receptor subfamily 1, group I, member 2, isoform CRA_c, partial [Homo sapiens]
GI:14702164 GenBank AAH17304.2 433 NR1I2 protein [Homo sapiens]
GI:34398348 GenBank ABR09276.1 473 nuclear receptor subfamily 1, group I, member 2 [Homo sapiens]
GI:11863132 GenBank ACM82015.1 484 Sequence 7513 from patent US 6812339
GI:11863132 GenBank ACM82016.1 484 Sequence 7514 from patent US 6812339
GI:11863132 GenBank ACM82017.1 484 Sequence 7515 from patent US 6812339
GI:34398348 GenBank ADZ17348.1 473 pregnane X nuclear receptor variant 2 [Homo sapiens]
GI:11863132 GenBank ADZ17384.1 470 pregnane X nuclear receptor [Homo sapiens]
GI:14702164 GenBank AED70872.1 397 Sequence 29 from patent US 7910303
GI:14702164 GenBank AFQ69644.1 397 Sequence 29 from patent US 8227189
GI:34398348 RefSeq NP_071285.1 473 nuclear receptor subfamily 1 group I member 2 isoform 2 [Homo sapiens]
GI:11863132 RefSeq XP_001164074.1 473 PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X3 [Pan troglodytes]
GI:11863132 RefSeq XP_004036179.1 473 PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform 1 [Gorilla gorilla gorilla]