Gene/Proteome Database (LMPD)
LMPD ID
LMP000940
Gene ID
Species
Homo sapiens (Human)
Gene Name
protein arginine methyltransferase 2
Gene Symbol
Synonyms
HRMT1L1
Alternate Names
protein arginine N-methyltransferase 2; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1
Chromosome
21
Map Location
21q22.3
EC Number
2.1.1.-
Proteins
| protein arginine N-methyltransferase 2 isoform 1 | |
|---|---|
| Refseq ID | NP_001526 |
| Protein GI | 46255047 |
| UniProt ID | P55345 |
| mRNA ID | NM_001535 |
| Length | 433 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR | |
| protein arginine N-methyltransferase 2 isoform 1 | |
|---|---|
| Refseq ID | NP_996845 |
| Protein GI | 46255049 |
| UniProt ID | P55345 |
| mRNA ID | NM_206962 |
| Length | 433 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:46255047 (mRNA isoform) | |
| protein arginine N-methyltransferase 2 isoform 2 | |
|---|---|
| Refseq ID | NP_001229793 |
| Protein GI | 338968840 |
| UniProt ID | P55345 |
| mRNA ID | NM_001242864 |
| Length | 331 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLTLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR | |
| protein arginine N-methyltransferase 2 isoform 3 | |
|---|---|
| Refseq ID | NP_001229794 |
| Protein GI | 338968842 |
| UniProt ID | P55345 |
| mRNA ID | NM_001242865 |
| Length | 284 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLAAPLLSCRILPCTCASGPLHVLLACCLPLPCTCASVPLHVLLACCLPVLRAPQPSGLHLSWPIFLL | |
| protein arginine N-methyltransferase 2 isoform 4 | |
|---|---|
| Refseq ID | NP_001229795 |
| Protein GI | 338968845 |
| UniProt ID | P55345 |
| mRNA ID | NM_001242866 |
| Length | 277 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALK | |
| protein arginine N-methyltransferase 2 isoform 5 | |
|---|---|
| Refseq ID | NP_001273605 |
| Protein GI | 557878719 |
| UniProt ID | P55345 |
| mRNA ID | NM_001286676 |
| Length | 301 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLHHTLEADAVHDGRPSPCPYRRRGHGFSCVAEKPSVEKAHVCGSELGCHFQTRPHISKSWRKSLPHLEMTVDALFGKQCAYLEG | |
| protein arginine N-methyltransferase 2 isoform 6 | |
|---|---|
| Refseq ID | NP_001273606 |
| Protein GI | 557878717 |
| UniProt ID | P55345 |
| mRNA ID | NM_001286677 |
| Length | 289 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKLEKKSSPSGDDS | |
| protein arginine N-methyltransferase 2 isoform 7 | |
|---|---|
| Refseq ID | NP_001273607 |
| Protein GI | 557878721 |
| UniProt ID | P55345 |
| mRNA ID | NM_001286678 |
| Length | 228 |
| RefSeq Status | VALIDATED |
| MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLVGEKVFPIWR | |
Gene Information
Entrez Gene ID
Gene Name
protein arginine methyltransferase 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0050681 | IPI:UniProtKB | F | androgen receptor binding |
| GO:0030331 | IDA:UniProtKB | F | estrogen receptor binding |
| GO:0042054 | IDA:UniProtKB | F | histone methyltransferase activity |
| GO:0008469 | ISS:UniProtKB | F | histone-arginine N-methyltransferase activity |
| GO:0042975 | IPI:UniProtKB | F | peroxisome proliferator activated receptor binding |
| GO:0033142 | IPI:UniProtKB | F | progesterone receptor binding |
| GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
| GO:0016274 | ISS:UniProtKB | F | protein-arginine N-methyltransferase activity |
| GO:0035242 | IBA:RefGenome | F | protein-arginine omega-N asymmetric methyltransferase activity |
| GO:0042974 | IPI:UniProtKB | F | retinoic acid receptor binding |
| GO:0004871 | TAS:ProtInc | F | signal transducer activity |
| GO:0046966 | IPI:UniProtKB | F | thyroid hormone receptor binding |
| GO:0003713 | IDA:UniProtKB | F | transcription coactivator activity |
| GO:0048588 | ISS:UniProtKB | P | developmental cell growth |
| GO:0034969 | IBA:RefGenome | P | histone arginine methylation |
| GO:0016571 | IDA:UniProtKB | P | histone methylation |
| GO:2000134 | ISS:UniProtKB | P | negative regulation of G1/S transition of mitotic cell cycle |
| GO:0032088 | IDA:UniProtKB | P | negative regulation of NF-kappaB transcription factor activity |
| GO:0045892 | IDA:UniProtKB | P | negative regulation of transcription, DNA-templated |
| GO:0019919 | IBA:RefGenome | P | peptidyl-arginine methylation, to asymmetrical-dimethyl arginine |
| GO:0043065 | IGI:UniProtKB | P | positive regulation of apoptotic process |
| GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
| GO:0006479 | TAS:ProtInc | P | protein methylation |
| GO:0060765 | IDA:UniProtKB | P | regulation of androgen receptor signaling pathway |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein arginine methyltransferase 2
Protein Entry
ANM2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=7; Name=1; IsoId=P55345-1; Sequence=Displayed; Name=2; IsoId=P55345-2; Sequence=VSP_042680; Note=No experimental confirmation available.; Name=3; IsoId=P55345-3; Sequence=VSP_043381; Note=No experimental confirmation available.; Name=PRMT2Alpha; IsoId=P55345-4; Sequence=VSP_054930, VSP_054931; Note=Higher expression in breast cancer tissues.; Name=PRMT2Beta; IsoId=P55345-5; Sequence=VSP_054928, VSP_054932; Note=Higher expression in breast cancer tissues. Doesn't interact with ESR1.; Name=PRMT2Gamma; IsoId=P55345-6; Sequence=VSP_054927; Note=Higher expression in breast cancer tissues.; Name=PRMT2L2; IsoId=P55345-7; Sequence=VSP_054929; |
| Biophysicochemical Properties | Kinetic parameters: KM=2.6 uM for AdoMet ; KM=3.3 uM for H4 ; Vmax=1.4 nmol/min/mg enzyme toward AdoMet ; Vmax=1.5 nmol/min/mg enzyme toward H4 ; |
| Catalytic Activity | S-adenosyl-L-methionine + arginine-[histone] = S-adenosyl-L-homocysteine + N(omega)-methyl-arginine-[histone]. |
| Function | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1- dependent manner). May be involved in growth regulation. {ECO |
| Interaction | P03372:ESR1; NbExp=9; IntAct=EBI-78458, EBI-78473; P06400:RB1; NbExp=3; IntAct=EBI-78458, EBI-491274; |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N- methyltransferase family. |
| Similarity | Contains 1 SAM-dependent MTase PRMT-type domain. |
| Similarity | Contains 1 SH3 domain. {ECO |
| Subcellular Location | Isoform 1: Cytoplasm. Nucleus. Note=Translocates from the cytoplasm to the nucleus, after hormone exposure. Excluded from nucleolus. |
| Subcellular Location | Isoform PRMT2Alpha: Nucleus. Note=Excluded from nucleolus. |
| Subcellular Location | Isoform PRMT2Beta: Cytoplasm. Nucleus. Nucleus, nucleolus. |
| Subcellular Location | Isoform PRMT2Gamma: Nucleus. Note=Excluded from nucleolus. |
| Subcellular Location | Isoform PRMT2L2: Cytoplasm . Nucleus . Note=Predominantly cytoplasmic. |
| Subunit | Self-associates. Interacts with RB1 and E2F1 (By similarity). Interacts with NCOA6 coactivator. Interacts (via SH3 domain) with PRMT8. Interacts with AR. Interacts with NFKBIA. Interacts with ESR1, ESR2, PGR, PPARG, RARA, RXRA and THRB. Interacts with HNRNPUL1. {ECO |
| Tissue Specificity | Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000940 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 46255047 | RefSeq | NP_001526 | 433 | protein arginine N-methyltransferase 2 isoform 1 |
| 338968840 | RefSeq | NP_001229793 | 331 | protein arginine N-methyltransferase 2 isoform 2 |
| 338968842 | RefSeq | NP_001229794 | 284 | protein arginine N-methyltransferase 2 isoform 3 |
| 338968845 | RefSeq | NP_001229795 | 277 | protein arginine N-methyltransferase 2 isoform 4 |
| 557878719 | RefSeq | NP_001273605 | 301 | protein arginine N-methyltransferase 2 isoform 5 |
| 557878717 | RefSeq | NP_001273606 | 289 | protein arginine N-methyltransferase 2 isoform 6 |
| 557878721 | RefSeq | NP_001273607 | 228 | protein arginine N-methyltransferase 2 isoform 7 |
Identical Sequences to LMP000940 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:338968842 | GenBank | AAB50221.1 | 284 | arginine methyltransferase [Homo sapiens] |
| GI:338968840 | GenBank | AAI00027.1 | 331 | PRMT2 protein [Homo sapiens] |
| GI:338968845 | GenBank | AAV48568.2 | 277 | PRMT2L2 [Homo sapiens] |
| GI:338968845 | GenBank | EAX09259.1 | 277 | protein arginine methyltransferase 2, isoform CRA_b [Homo sapiens] |
| GI:338968842 | GenBank | EAX09265.1 | 284 | protein arginine methyltransferase 2, isoform CRA_e, partial [Homo sapiens] |
| GI:557878717 | GenBank | ACJ66866.1 | 289 | PRMT2 alpha variant [Homo sapiens] |
| GI:557878719 | GenBank | ACJ66867.1 | 301 | PRMT2 beta variant [Homo sapiens] |
| GI:557878721 | GenBank | ACJ66868.1 | 228 | PRMT2 gamma variant [Homo sapiens] |
| GI:46255047 | GenBank | AFG96345.1 | 433 | Sequence 8 from patent US 8148124 |
| GI:46255047 | GenBank | AFO15029.1 | 433 | Sequence 513 from patent US 8211634 |
| GI:46255047 | GenBank | AFQ82092.1 | 433 | Sequence 8 from patent US 8247168 |
| GI:46255047 | GenBank | AGD01547.1 | 433 | Sequence 1070 from patent US 8338124 |
| GI:46255047 | GenBank | AGD01548.1 | 433 | Sequence 1071 from patent US 8338124 |
| GI:46255047 | RefSeq | XP_005261168.1 | 433 | PREDICTED: protein arginine N-methyltransferase 2 isoform X1 [Homo sapiens] |
| GI:557878719 | RefSeq | XP_006724061.1 | 301 | PREDICTED: protein arginine N-methyltransferase 2 isoform X2 [Homo sapiens] |
| GI:557878721 | RefSeq | XP_006724063.1 | 228 | PREDICTED: protein arginine N-methyltransferase 2 isoform X4 [Homo sapiens] |
Related Sequences to LMP000940 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:557878717 | EMBL | CAG46603.1 | 433 | HRMT1L1, partial [Homo sapiens] |
| GI:557878721 | EMBL | CAG46603.1 | 433 | HRMT1L1, partial [Homo sapiens] |
| GI:338968845 | EMBL | CAG46603.1 | 433 | HRMT1L1, partial [Homo sapiens] |
| GI:557878721 | EMBL | CBX51391.1 | 433 | unnamed protein product [Homo sapiens] |
| GI:557878717 | EMBL | CBX51391.1 | 433 | unnamed protein product [Homo sapiens] |
| GI:338968845 | EMBL | CBX51391.1 | 433 | unnamed protein product [Homo sapiens] |
| GI:557878721 | GenBank | AAI00027.1 | 331 | PRMT2 protein [Homo sapiens] |
| GI:338968845 | GenBank | ADC20586.1 | 433 | Sequence 1070 from patent US 7638288 |
| GI:557878717 | GenBank | ADC20586.1 | 433 | Sequence 1070 from patent US 7638288 |
| GI:46255047 | GenBank | JAA16586.1 | 433 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:46255047 | GenBank | JAA16587.1 | 433 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:46255047 | GenBank | JAA29848.1 | 433 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:46255047 | GenBank | JAA43229.1 | 433 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:46255047 | GenBank | JAA43230.1 | 433 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:338968840 | GenBank | JAA43231.1 | 331 | protein arginine methyltransferase 2 [Pan troglodytes] |
| GI:557878717 | GenBank | AGD01547.1 | 433 | Sequence 1070 from patent US 8338124 |
| GI:338968845 | GenBank | AGD01547.1 | 433 | Sequence 1070 from patent US 8338124 |
| GI:557878717 | GenBank | AGD01548.1 | 433 | Sequence 1071 from patent US 8338124 |
| GI:338968845 | GenBank | AGD01548.1 | 433 | Sequence 1071 from patent US 8338124 |
| GI:557878721 | RefSeq | NP_996845.1 | 433 | protein arginine N-methyltransferase 2 isoform 1 [Homo sapiens] |
| GI:338968845 | RefSeq | NP_996845.1 | 433 | protein arginine N-methyltransferase 2 isoform 1 [Homo sapiens] |
| GI:557878717 | RefSeq | NP_996845.1 | 433 | protein arginine N-methyltransferase 2 isoform 1 [Homo sapiens] |
| GI:46255047 | RefSeq | XP_001161405.1 | 433 | PREDICTED: protein arginine N-methyltransferase 2 isoform X1 [Pan troglodytes] |
| GI:557878721 | RefSeq | NP_001229793.1 | 331 | protein arginine N-methyltransferase 2 isoform 2 [Homo sapiens] |
| GI:338968842 | RefSeq | XP_003949255.1 | 284 | PREDICTED: protein arginine N-methyltransferase 2 isoform X4 [Pan troglodytes] |
| GI:338968840 | RefSeq | XP_004063006.1 | 331 | PREDICTED: protein arginine N-methyltransferase 2 isoform 3 [Gorilla gorilla gorilla] |
| GI:338968840 | RefSeq | XP_004594132.1 | 331 | PREDICTED: protein arginine N-methyltransferase 2 isoform X2 [Ochotona princeps] |
| GI:338968840 | RefSeq | XP_004631879.1 | 333 | PREDICTED: protein arginine N-methyltransferase 2 isoform X2 [Octodon degus] |
| GI:338968840 | RefSeq | XP_005376011.1 | 333 | PREDICTED: protein arginine N-methyltransferase 2 isoform X15 [Chinchilla lanigera] |
| GI:338968840 | RefSeq | XP_005548527.1 | 331 | PREDICTED: protein arginine N-methyltransferase 2 isoform X4 [Macaca fascicularis] |
| GI:557878721 | RefSeq | XP_006724062.1 | 287 | PREDICTED: protein arginine N-methyltransferase 2 isoform X3 [Homo sapiens] |
| GI:338968842 | RefSeq | XP_006724062.1 | 287 | PREDICTED: protein arginine N-methyltransferase 2 isoform X3 [Homo sapiens] |
| GI:557878719 | RefSeq | XP_006724062.1 | 287 | PREDICTED: protein arginine N-methyltransferase 2 isoform X3 [Homo sapiens] |
| GI:557878719 | RefSeq | XP_006758826.1 | 324 | PREDICTED: protein arginine N-methyltransferase 2 isoform X2 [Myotis davidii] |
| GI:557878719 | RefSeq | XP_007969538.1 | 301 | PREDICTED: protein arginine N-methyltransferase 2 isoform X5 [Chlorocebus sabaeus] |
| GI:557878719 | RefSeq | XP_008540082.1 | 308 | PREDICTED: protein arginine N-methyltransferase 2 isoform X3 [Equus przewalskii] |
| GI:338968842 | RefSeq | XP_008975712.1 | 284 | PREDICTED: protein arginine N-methyltransferase 2 isoform X6 [Pan paniscus] |
| GI:338968842 | RefSeq | XP_008975713.1 | 284 | PREDICTED: protein arginine N-methyltransferase 2 isoform X6 [Pan paniscus] |
| GI:557878719 | RefSeq | XP_008975718.1 | 301 | PREDICTED: protein arginine N-methyltransferase 2 isoform X11 [Pan paniscus] |
| GI:338968842 | RefSeq | XP_009440492.1 | 284 | PREDICTED: protein arginine N-methyltransferase 2 isoform X4 [Pan troglodytes] |
| GI:557878719 | RefSeq | XP_009440499.1 | 241 | PREDICTED: protein arginine N-methyltransferase 2 isoform X5 [Pan troglodytes] |
| GI:338968842 | RefSeq | XP_010368391.1 | 284 | PREDICTED: protein arginine N-methyltransferase 2 isoform X3 [Rhinopithecus roxellana] |