Gene/Proteome Database (LMPD)
Proteins
ganglioside GM2 activator precursor | |
---|---|
Refseq ID | NP_034429 |
Protein GI | 6806917 |
UniProt ID | Q5F1Z8 |
mRNA ID | NM_010299 |
Length | 193 |
RefSeq Status | VALIDATED |
MHRLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR | |
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2098 peptide sequence: MHRLPLLLLLGLLLAGSVAP mat_peptide: 21..193 product: Ganglioside GM2 activator experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q60648.2) calculated_mol_wt: 18745 peptide sequence: ARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR |
Gene Information
Entrez Gene ID
Gene Name
GM2 ganglioside activator protein
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0045179 | IEA:Ensembl | C | apical cortex |
GO:0009898 | IEA:Ensembl | C | cytoplasmic side of plasma membrane |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005889 | IEA:Ensembl | C | hydrogen:potassium-exchanging ATPase complex |
GO:0005764 | IEA:Ensembl | C | lysosome |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0032428 | IEA:Ensembl | F | beta-N-acetylgalactosaminidase activity |
GO:0004563 | IMP:MGI | F | beta-N-acetylhexosaminidase activity |
GO:0008047 | IDA:MGI | F | enzyme activator activity |
GO:0005319 | IEA:Ensembl | F | lipid transporter activity |
GO:0016004 | IEA:Ensembl | F | phospholipase activator activity |
GO:0006689 | IMP:MGI | P | ganglioside catabolic process |
GO:0007611 | IMP:MGI | P | learning or memory |
GO:0019915 | IMP:MGI | P | lipid storage |
GO:0050877 | IMP:MGI | P | neurological system process |
GO:0050885 | IMP:MGI | P | neuromuscular process controlling balance |
GO:0009313 | IMP:MGI | P | oligosaccharide catabolic process |
GO:0051345 | IEA:Ensembl | P | positive regulation of hydrolase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
GM2 ganglioside activator protein
Protein Entry
SAP3_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP000942 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6806917 | RefSeq | NP_034429 | 193 | ganglioside GM2 activator precursor |
Identical Sequences to LMP000942 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6806917 | DBBJ | BAE31075.1 | 193 | unnamed protein product [Mus musculus] |
GI:6806917 | EMBL | CAJ18497.1 | 193 | Gm2a [Mus musculus] |
GI:6806917 | GenBank | AAB06275.1 | 193 | GM2 activator protein [Mus musculus] |
GI:6806917 | GenBank | AAH04651.1 | 193 | GM2 ganglioside activator protein [Mus musculus] |
GI:6806917 | GenBank | EDL33503.1 | 193 | GM2 ganglioside activator protein [Mus musculus] |
GI:6806917 | SwissProt | Q60648.2 | 193 | RecName: Full=Ganglioside GM2 activator; AltName: Full=Cerebroside sulfate activator protein; AltName: Full=GM2-AP; AltName: Full=Sphingolipid activator protein 3; Short=SAP-3; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000942 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6806917 | DBBJ | BAC24018.1 | 199 | GM2 activator protein [Rattus norvegicus] |
GI:6806917 | GenBank | AAA21543.1 | 193 | GM2 activator protein [Mus musculus] |
GI:6806917 | GenBank | AAH72474.1 | 199 | GM2 ganglioside activator [Rattus norvegicus] |
GI:6806917 | GenBank | EDM04464.1 | 199 | GM2 ganglioside activator protein [Rattus norvegicus] |
GI:6806917 | RefSeq | NP_758838.2 | 199 | ganglioside GM2 activator precursor [Rattus norvegicus] |
GI:6806917 | RefSeq | XP_006984937.1 | 193 | PREDICTED: ganglioside GM2 activator [Peromyscus maniculatus bairdii] |