Gene/Proteome Database (LMPD)

LMPD ID
LMP001829
Gene ID
Species
Homo sapiens (Human)
Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Gene Symbol
Synonyms
SCEH
Alternate Names
enoyl-CoA hydratase, mitochondrial; enoyl-CoA hydratase 1; short-chain enoyl-CoA hydratase; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Chromosome
10
Map Location
10q26.2-q26.3
EC Number
4.2.1.17
Summary
The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

enoyl-CoA hydratase, mitochondrial
Refseq ID NP_004083
Protein GI 194097323
UniProt ID P30084
mRNA ID NM_004092
Length 290
RefSeq Status REVIEWED
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Gene Information

Entrez Gene ID
Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005759 TAS:Reactome C mitochondrial matrix
GO:0005739 TAS:UniProtKB C mitochondrion
GO:0004300 TAS:Reactome F enoyl-CoA hydratase activity
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0006635 TAS:Reactome P fatty acid beta-oxidation
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa01200 Carbon metabolism

Domain Information

InterPro Annotations

Accession Description
IPR029045 ClpP/crotonase-like domain
IPR001753 Crotonase_core_superfam
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site

UniProt Annotations

Entry Information

Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Protein Entry
ECHM_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl- CoA + H(2)O.
Function Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate.
Interaction Q5S007:LRRK2; NbExp=2; IntAct=EBI-719602, EBI-5323863; P40763:STAT3; NbExp=3; IntAct=EBI-719602, EBI-518675; P42227:Stat3 (xeno); NbExp=3; IntAct=EBI-719602, EBI-602878;
Pathway Lipid metabolism; fatty acid beta-oxidation.
Similarity Belongs to the enoyl-CoA hydratase/isomerase family.
Subcellular Location Mitochondrion matrix.
Subunit Homohexamer; dimer of trimers.
Tissue Specificity Liver, fibroblast, muscle. Barely detectable in spleen and kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP001829 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
194097323 RefSeq NP_004083 290 enoyl-CoA hydratase, mitochondrial

Identical Sequences to LMP001829 proteins

Reference Database Accession Length Protein Name
GI:194097323 SwissProt P30084.4 290 RecName: Full=Enoyl-CoA hydratase, mitochondrial; AltName: Full=Enoyl-CoA hydratase 1; AltName: Full=Short-chain enoyl-CoA hydratase; Short=SCEH; Flags: Precursor [Homo sapiens]

Related Sequences to LMP001829 proteins

Reference Database Accession Length Protein Name
GI:194097323 GenBank AAH08906.1 290 Enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [Homo sapiens]
GI:194097323 GenBank AAX32540.1 290 mitochondrial enoyl coenzyme A hydratase short chain 1 [synthetic construct]
GI:194097323 GenBank AAX32541.1 290 mitochondrial enoyl coenzyme A hydratase short chain 1 [synthetic construct]
GI:194097323 GenBank EAW61339.1 290 enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [Homo sapiens]
GI:194097323 GenBank ADT51564.1 290 Sequence 3581 from patent US 7842467
GI:194097323 GenBank AIC54316.1 290 ECHS1, partial [synthetic construct]