Gene/Proteome Database (LMPD)
LMPD ID
LMP001922
Gene ID
Species
Mus musculus (Mouse)
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Synonyms
1700011K09Rik; 4833424I06Rik; 4933429L05Rik; AI644424
Alternate Names
stAR-related lipid transfer protein 6; START domain containing protein 6; START domain-containing protein 6
Chromosome
18
Map Location
18 E2|18 44.44 cM
Proteins
stAR-related lipid transfer protein 6 | |
---|---|
Refseq ID | NP_083295 |
Protein GI | 21312812 |
UniProt ID | P59096 |
mRNA ID | NM_029019 |
Length | 233 |
RefSeq Status | VALIDATED |
MDYKAIAQQTAEQVLAYNQDLSGWKLIKSSKKVTVSSKTSRIFHGNLYRVEGIIPESAAHLSDFLFKHDHRVSWDKSLKGFNVIHKIDSDTLICHTITQSFAMGSISPRDFIDLVHIKHYERNVDIISTKSVDFPGYAPTSTYIRGFNHPSGYVCSPLKENPAYSKLVIFVQTEMKGKLPASVIEKSMPSNLVSFLLNVKDGVKTYRIPPIRARHSSHSSVHKKKEGHSAIKP |
stAR-related lipid transfer protein 6 | |
---|---|
Refseq ID | NP_001276579 |
Protein GI | 576067835 |
UniProt ID | P59096 |
mRNA ID | NM_001289650 |
Length | 233 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:21312812 (mRNA isoform) |
stAR-related lipid transfer protein 6 | |
---|---|
Refseq ID | NP_001276578 |
Protein GI | 576067890 |
UniProt ID | P59096 |
mRNA ID | NM_001289649 |
Length | 233 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:21312812 (mRNA isoform) |
stAR-related lipid transfer protein 6 | |
---|---|
Refseq ID | NP_001276577 |
Protein GI | 576067807 |
UniProt ID | P59096 |
mRNA ID | NM_001289648 |
Length | 233 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:21312812 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0015485 | ISA:MGI | F | cholesterol binding |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 6
Protein Entry
STAR6_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity). {ECO:0000250}. |
Similarity | Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}. |
Tissue Specificity | Testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001922 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21312812 | RefSeq | NP_083295 | 233 | stAR-related lipid transfer protein 6 |
Identical Sequences to LMP001922 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21312812 | GenBank | EDL09575.1 | 233 | StAR-related lipid transfer (START) domain containing 6, isoform CRA_a [Mus musculus] |
GI:21312812 | GenBank | EDL09577.1 | 233 | StAR-related lipid transfer (START) domain containing 6, isoform CRA_a [Mus musculus] |
GI:21312812 | GenBank | AEQ29831.1 | 233 | StARD6 [Mus musculus] |
GI:21312812 | RefSeq | NP_001276577.1 | 233 | stAR-related lipid transfer protein 6 [Mus musculus] |
GI:21312812 | RefSeq | NP_001276579.1 | 233 | stAR-related lipid transfer protein 6 [Mus musculus] |
GI:21312812 | RefSeq | NP_001276578.1 | 233 | stAR-related lipid transfer protein 6 [Mus musculus] |
Related Sequences to LMP001922 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21312812 | GenBank | EDM14781.1 | 227 | STAR-related lipid transfer (START) domain containing protein 6, isoform CRA_a [Rattus norvegicus] |
GI:21312812 | GenBank | EDM14783.1 | 227 | STAR-related lipid transfer (START) domain containing protein 6, isoform CRA_a [Rattus norvegicus] |
GI:21312812 | GenBank | AEQ29832.1 | 233 | StARD6 [Mus musculus] |
GI:21312812 | RefSeq | XP_006525760.1 | 231 | PREDICTED: stAR-related lipid transfer protein 6 isoform X3 [Mus musculus] |
GI:21312812 | RefSeq | XP_008770333.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |
GI:21312812 | RefSeq | XP_008770334.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |