Gene/Proteome Database (LMPD)

LMPD ID
LMP002053
Gene ID
16204
Species
Mus musculus (Mouse)
Gene Name
fatty acid binding protein 6, ileal (gastrotropin)
Gene Symbol
Fabp6
Synonyms
GT; I-15P; I-BABP; ILBP; ILBP3; Illbp
Alternate Names
gastrotropin; ileal lipid-binding protein; fatty acid-binding protein 6; ileal bile acid-binding protein
Chromosome
11
Map Location
11 B1.1|11 25.81 cM
Summary
The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within the ileum, the distal 25-30% of the small intestine, and plays a role in enterohepatic circulation of bile acids and cholesterol homeostasis. In humans, it has been reported that polymorphisms in FABP6 confer a protective effect in obese individuals from developing type 2 diabetes. In mice deficiency of this gene affects bile acid metabolism in a gender-specific manner and was reported to be required for efficient apical to basolateral transport of conjugated bile acids. [provided by RefSeq, Jan 2013]
Orthologs
View orthologs and multiple alignments for Fabp6

Proteins

gastrotropin
Refseq ID NP_032401
Protein GI 6680441
UniProt ID P51162
mRNA ID NM_008375
Length 128
RefSeq Status REVIEWED
MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRLA

Gene Information

Entrez Gene ID
16204
Gene Name
fatty acid binding protein 6, ileal (gastrotropin)
Gene Symbol
Fabp6
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0008206 TAS:MGI P bile acid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mmu03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5893229 Recycling of bile acids and salts

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 6, ileal (gastrotropin)
Protein Entry
FABP6_MOUSE
UniProt ID
P51162
Species
Mouse

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP002053 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6680441 RefSeq NP_032401 128 gastrotropin

Identical Sequences to LMP002053 proteins

Reference Database Accession Length Protein Name
GI:6680441 GenBank AAC27352.1 128 ileal lipid-binding protein [Mus musculus]
GI:6680441 GenBank AAI20768.1 128 Fatty acid binding protein 6, ileal (gastrotropin) [Mus musculus]
GI:6680441 GenBank AAI19290.1 128 Fatty acid binding protein 6, ileal (gastrotropin) [Mus musculus]
GI:6680441 GenBank EDL33855.1 128 fatty acid binding protein 6, ileal (gastrotropin) [Mus musculus]
GI:6680441 SwissProt P51162.2 128 RecName: Full=Gastrotropin; Short=GT; AltName: Full=Fatty acid-binding protein 6; AltName: Full=Ileal lipid-binding protein; Short=ILBP [Mus musculus]

Related Sequences to LMP002053 proteins

Reference Database Accession Length Protein Name
GI:6680441 GenBank AAB24948.1 128 intestinal 15 kda protein [Rattus sp.]
GI:6680441 GenBank AAA57155.1 128 bile acid-binding protein [Rattus norvegicus]
GI:6680441 GenBank EDM04137.1 128 fatty acid binding protein 6, ileal (gastrotropin) [Rattus norvegicus]
GI:6680441 RefSeq NP_058794.1 128 gastrotropin [Rattus norvegicus]
GI:6680441 RefSeq XP_006971671.1 128 PREDICTED: gastrotropin [Peromyscus maniculatus bairdii]
GI:6680441 SwissProt P80020.3 128 RecName: Full=Gastrotropin; Short=GT; AltName: Full=14 kDa bile acid-binding protein; AltName: Full=Fatty acid-binding protein 6; AltName: Full=I-BABP; AltName: Full=Ileal lipid-binding protein; Short=ILBP; AltName: Full=Intestinal 15 kDa protein; Short=I-15P [Rattus norvegicus]