Gene/Proteome Database (LMPD)

LMPD ID
LMP002502
Gene ID
Species
Mus musculus (Mouse)
Gene Name
leukotriene C4 synthase
Gene Symbol
Synonyms
-
Alternate Names
leukotriene C4 synthase; LTC4 synthase; leukotriene-C(4) synthase
Chromosome
11
Map Location
11|11 B1.1-B1.2
EC Number
4.4.1.20

Proteins

leukotriene C4 synthase
Refseq ID NP_032547
Protein GI 6678734
UniProt ID Q60860
mRNA ID NM_008521
Length 150
RefSeq Status PROVISIONAL
MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQMLLPMA

Gene Information

Entrez Gene ID
Gene Name
leukotriene C4 synthase
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IBA:RefGenome C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0004602 IBA:RefGenome F glutathione peroxidase activity
GO:0004364 IBA:RefGenome F glutathione transferase activity
GO:0004464 IDA:MGI F leukotriene-C4 synthase activity
GO:0008289 IDA:MGI F lipid binding
GO:0019370 IBA:RefGenome P leukotriene biosynthetic process
GO:0006691 IDA:MGI P leukotriene metabolic process
GO:0055114 IBA:GOC P oxidation-reduction process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00590 Arachidonic acid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893606 Synthesis of 5-eicosatetraenoic acids
5894063 Synthesis of Lipoxins (LX)

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
leukotriene C4 synthase
Protein Entry
LTC4S_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Leukotriene C(4) = leukotriene A(4) + glutathione.
Function Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4.
Similarity Belongs to the MAPEG family. {ECO:0000305}.
Subcellular Location Nucleus outer membrane {ECO:0000250}; Multi- pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Homotrimer. Interacts with ALOX5AP and ALOX5 (By similarity). {ECO:0000250}.
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:8706658}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002502 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6678734 RefSeq NP_032547 150 leukotriene C4 synthase

Identical Sequences to LMP002502 proteins

Reference Database Accession Length Protein Name
GI:6678734 GenBank AAA75042.1 150 leukotriene C4 synthase [Mus musculus]
GI:6678734 GenBank EDL33714.1 150 leukotriene C4 synthase, isoform CRA_f [Mus musculus]
GI:6678734 SwissProt Q60860.1 150 RecName: Full=Leukotriene C4 synthase; Short=LTC4 synthase; AltName: Full=Leukotriene-C(4) synthase [Mus musculus]

Related Sequences to LMP002502 proteins

Reference Database Accession Length Protein Name
GI:6678734 DBBJ BAB58882.2 150 leukotriene C4 synthase [Rattus norvegicus]
GI:6678734 GenBank EDM04261.1 150 leukotriene C4 synthase, isoform CRA_a [Rattus norvegicus]
GI:6678734 RefSeq NP_446091.2 150 leukotriene C4 synthase [Rattus norvegicus]
GI:6678734 RefSeq XP_005350211.1 150 PREDICTED: leukotriene C4 synthase [Microtus ochrogaster]
GI:6678734 RefSeq XP_008765877.1 150 PREDICTED: leukotriene C4 synthase isoform X1 [Rattus norvegicus]
GI:6678734 SwissProt Q925U2.2 150 RecName: Full=Leukotriene C4 synthase; Short=LTC4 synthase; AltName: Full=Leukotriene-C(4) synthase [Rattus norvegicus]