Gene/Proteome Database (LMPD)

LMPD ID
LMP002537
Gene ID
56895
Species
Homo sapiens (Human)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
AGPAT4
Synonyms
1-AGPAT4; LPAAT-delta; dJ473J16.2
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-AGPAT 4; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta (LPAAT-delta); 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Chromosome
6
Map Location
6q26
EC Number
2.3.1.51
Summary
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for AGPAT4

Proteins

1-acyl-sn-glycerol-3-phosphate acyltransferase delta
Refseq ID NP_064518
Protein GI 9910392
UniProt ID Q9NRZ5
mRNA ID NM_020133
Length 378
RefSeq Status REVIEWED
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND

Gene Information

Entrez Gene ID
56895
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
AGPAT4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003841 NAS:UniProtKB F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0006654 TAS:Reactome P phosphatidic acid biosynthetic process
GO:0008654 NAS:UniProtKB P phospholipid biosynthetic process
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0019432 TAS:Reactome P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00561 Glycerolipid metabolism
hsa00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_120906 Synthesis of PA

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Protein Entry
PLCD_HUMAN
UniProt ID
Q9NRZ5
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NRZ5-1; Sequence=Displayed; Name=2; IsoId=Q9NRZ5-2; Sequence=VSP_056928, VSP_056929; Note=No experimental confirmation available;
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
Interaction P46108:CRK; NbExp=1; IntAct=EBI-1754287, EBI-886;
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Subcellular Location Membrane ; Multi-pass membrane protein .
Tissue Specificity Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus.

Identical and Related Proteins

Unique RefSeq proteins for LMP002537 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9910392 RefSeq NP_064518 378 1-acyl-sn-glycerol-3-phosphate acyltransferase delta

Identical Sequences to LMP002537 proteins

Reference Database Accession Length Protein Name
GI:9910392 GenBank ADL85806.1 378 Sequence 420 from patent US 7704496
GI:9910392 GenBank ADL95891.1 378 Sequence 420 from patent US 7718173
GI:9910392 GenBank AFL59770.1 378 Sequence 420 from patent US 8106156
GI:9910392 GenBank AHD72053.1 378 Sequence 7551 from patent US 8586006
GI:9910392 RefSeq XP_006715575.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X5 [Homo sapiens]
GI:9910392 RefSeq XP_006715576.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X6 [Homo sapiens]

Related Sequences to LMP002537 proteins

Reference Database Accession Length Protein Name
GI:9910392 GenBank JAA01612.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes]
GI:9910392 GenBank JAA13651.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes]
GI:9910392 GenBank JAA25779.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes]
GI:9910392 GenBank JAA40740.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes]
GI:9910392 RefSeq XP_008971881.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Pan paniscus]
GI:9910392 RefSeq XP_008971882.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Pan paniscus]