Gene/Proteome Database (LMPD)

LMPD ID
LMP002628
Gene ID
Species
Homo sapiens (Human)
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Synonyms
CD363; CHEDG1; D1S3362; ECGF1; EDG-1; EDG1; S1P1
Alternate Names
sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
Chromosome
1
Map Location
1p21
Summary
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

sphingosine 1-phosphate receptor 1
Refseq ID NP_001391
Protein GI 13027636
UniProt ID P21453
mRNA ID NM_001400
Length 382
RefSeq Status REVIEWED
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS

Gene Information

Entrez Gene ID
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0031226 IDA:UniProtKB C intrinsic component of plasma membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0004930 TAS:ProtInc F G-protein coupled receptor activity
GO:0001664 IPI:UniProtKB F G-protein coupled receptor binding
GO:0046625 IEA:Ensembl F sphingolipid binding
GO:0038036 IDA:UniProtKB F sphingosine-1-phosphate receptor activity
GO:0007186 TAS:ProtInc P G-protein coupled receptor signaling pathway
GO:0072678 ISS:UniProtKB P T cell migration
GO:0031532 ISS:UniProtKB P actin cytoskeleton reorganization
GO:0007193 IEA:Ensembl P adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
GO:0001525 IEA:UniProtKB-KW P angiogenesis
GO:0001955 ISS:UniProtKB P blood vessel maturation
GO:0007420 IEA:Ensembl P brain development
GO:0003245 ISS:UniProtKB P cardiac muscle tissue growth involved in heart morphogenesis
GO:0007155 TAS:ProtInc P cell adhesion
GO:0016477 ISS:UniProtKB P cell migration
GO:0006935 ISS:UniProtKB P chemotaxis
GO:0045446 IEA:Ensembl P endothelial cell differentiation
GO:0061384 ISS:UniProtKB P heart trabecula morphogenesis
GO:0030032 ISS:UniProtKB P lamellipodium assembly
GO:0051497 IEA:Ensembl P negative regulation of stress fiber assembly
GO:0030182 IEA:Ensembl P neuron differentiation
GO:0032320 IEA:Ensembl P positive regulation of Ras GTPase activity
GO:0030335 IEA:Ensembl P positive regulation of cell migration
GO:0051482 IEA:Ensembl P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
GO:0050927 IEA:Ensembl P positive regulation of positive chemotaxis
GO:0048661 IEA:Ensembl P positive regulation of smooth muscle cell proliferation
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0030500 ISS:UniProtKB P regulation of bone mineralization
GO:0045124 ISS:UniProtKB P regulation of bone resorption
GO:0030155 IEA:Ensembl P regulation of cell adhesion
GO:0003376 IDA:UniProtKB P sphingosine-1-phosphate signaling pathway
GO:0019226 IEA:Ensembl P transmission of nerve impulse

KEGG Pathway Links

KEGG Pathway ID Description
hsa04068 FoxO signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_19231 G alpha (i) signalling events

Domain Information

InterPro Annotations

Accession Description
IPR000987 EDG-1 sphingosine 1-phosphate receptor
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR004061 Sphingosine 1-phosphate receptor

UniProt Annotations

Entry Information

Gene Name
sphingosine-1-phosphate receptor 1
Protein Entry
S1PR1_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis (By similarity). Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3- phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury. {ECO
Induction By the tumor promoter phorbol 12-myristate 13-acetate (PMA) in the presence of cycloheximide.
Ptm S1P-induced endothelial cell migration requires the PKB/AKT1- mediated phosphorylation of the third intracellular loop at the Thr-236 residue. {ECO
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft. Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl- 2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization.
Subunit Interacts with GNAI1 and GNAI3.
Tissue Specificity Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.

Identical and Related Proteins

Unique RefSeq proteins for LMP002628 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13027636 RefSeq NP_001391 382 sphingosine 1-phosphate receptor 1

Identical Sequences to LMP002628 proteins

Reference Database Accession Length Protein Name
GI:13027636 GenBank ADF24393.1 382 Sequence 31 from patent US 7691563
GI:13027636 GenBank AED45322.1 382 Sequence 786 from patent US 7892730
GI:13027636 GenBank AEU56593.1 382 Sequence 105 from patent US 8067189
GI:13027636 GenBank AHD70803.1 382 Sequence 4271 from patent US 8586006
GI:13027636 GenBank AIC48672.1 382 S1PR1, partial [synthetic construct]
GI:13027636 RefSeq XP_006710462.1 382 PREDICTED: sphingosine 1-phosphate receptor 1 isoform X1 [Homo sapiens]

Related Sequences to LMP002628 proteins

Reference Database Accession Length Protein Name
GI:13027636 GenBank AAU98835.1 381 Sequence 19 from patent US 6730663
GI:13027636 GenBank AAX29856.1 383 endothelial differentiation sphingolipid G-protein-coupled receptor 1, partial [synthetic construct]
GI:13027636 GenBank AAX36974.1 383 endothelial differentiation sphingolipid G-protein-coupled receptor 1, partial [synthetic construct]
GI:13027636 RefSeq XP_001138918.1 382 PREDICTED: sphingosine 1-phosphate receptor 1 [Pan troglodytes]
GI:13027636 RefSeq XP_002690742.2 312 PREDICTED: olfactory receptor 4K13 [Bos taurus]
GI:13027636 RefSeq XP_004026264.1 382 PREDICTED: sphingosine 1-phosphate receptor 1 isoform 1 [Gorilla gorilla gorilla]