Gene/Proteome Database (LMPD)

LMPD ID
LMP002728
Gene ID
Species
Mus musculus (Mouse)
Gene Name
H2-K region expressed gene 6
Gene Symbol
Synonyms
D17H6S112E; H-2Ke6; Hsd17b8; Ke-6; Ke6; Ring2
Alternate Names
estradiol 17-beta-dehydrogenase 8; 17-beta-HSD 8; estrogen 17-oxidoreductase; testosterone 17-beta-dehydrogenase 8; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase
Chromosome
17
Map Location
17 B1|17 17.98 cM
EC Number
1.1.1.62

Proteins

estradiol 17-beta-dehydrogenase 8
Refseq ID NP_038571
Protein GI 157951743
UniProt ID P50171
mRNA ID NM_013543
Length 259
RefSeq Status VALIDATED
MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSEDGAPRGKHAAFQADVSQGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGGLFM

Gene Information

Entrez Gene ID
Gene Name
H2-K region expressed gene 6
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IDA:MGI C membrane
GO:0005740 IDA:MGI C mitochondrial envelope
GO:0005759 IEA:Ensembl C mitochondrial matrix
GO:0005739 IDA:MGI C mitochondrion
GO:0005886 IDA:MGI C plasma membrane
GO:0003857 IEA:Ensembl F 3-hydroxyacyl-CoA dehydrogenase activity
GO:0004303 ISS:UniProtKB F estradiol 17-beta-dehydrogenase activity
GO:0047035 IDA:MGI F testosterone dehydrogenase (NAD+) activity
GO:0008209 IDA:MGI P androgen metabolic process
GO:0006703 ISS:UniProtKB P estrogen biosynthetic process
GO:0008210 IDA:MGI P estrogen metabolic process
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu01100 Metabolic pathways
ko00140 Steroid hormone biosynthesis
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
H2-K region expressed gene 6
Protein Entry
DHB8_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=Short; IsoId=P50171-1; Sequence=Displayed; Name=Long; IsoId=P50171-2; Sequence=VSP_006030;
Biophysicochemical Properties Kinetic parameters: KM=0.110 uM for estradiol {ECO:0000269|PubMed:9712896}; KM=0.422 uM for testosterone {ECO:0000269|PubMed:9712896}; KM=0.368 uM for estrone {ECO:0000269|PubMed:9712896}; KM=0.360 uM for dihydrotestosterone {ECO:0000269|PubMed:9712896}; Vmax=0.405 nmol/min/mg enzyme for estradiol as substrate {ECO:0000269|PubMed:9712896}; Vmax=0.123 nmol/min/mg enzyme for testosterone as substrate {ECO:0000269|PubMed:9712896}; Vmax=0.186 nmol/min/mg enzyme for estrone as substrate {ECO:0000269|PubMed:9712896}; Vmax=0.081 nmol/min/mg enzyme for dihydrotestosterone as substrate {ECO:0000269|PubMed:9712896};
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. {ECO:0000269|PubMed:9712896}.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH. {ECO:0000269|PubMed:9712896}.
Function NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone (By similarity). The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria (By similarity). {ECO:0000250}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Pathway Steroid biosynthesis; estrogen biosynthesis.
Sequence Caution Sequence=AAC69902.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Mitochondrion matrix {ECO:0000250}.
Subunit Heterotetramer with CBR4; contains two molecules of HSD17B8 and CBR4. {ECO:0000250}.
Tissue Specificity Kidney, liver, testis, ovary, oviduct, uterus, mammary gland, vagina, prostate, clitoral gland and moderately in spleen, heart, dorsal skin, brain and lung.

Identical and Related Proteins

Unique RefSeq proteins for LMP002728 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157951743 RefSeq NP_038571 259 estradiol 17-beta-dehydrogenase 8

Identical Sequences to LMP002728 proteins

Reference Database Accession Length Protein Name
GI:157951743 GenBank AAH86927.1 259 H2-Ke6 protein [Mus musculus]
GI:157951743 SwissProt P50171.2 259 RecName: Full=Estradiol 17-beta-dehydrogenase 8; AltName: Full=17-beta-hydroxysteroid dehydrogenase 8; Short=17-beta-HSD 8; AltName: Full=3-oxoacyl-[acyl-carrier-protein] reductase; AltName: Full=Protein Ke6; Short=Ke-6; AltName: Full=Testosterone 17-beta-dehydrogenase 8 [Mus musculus]

Related Sequences to LMP002728 proteins

Reference Database Accession Length Protein Name
GI:157951743 EMBL CAE83931.1 259 hydroxysteroid (17-beta) dehydrogenase 8 [Rattus norvegicus]
GI:157951743 EMBL CBF61750.1 259 unnamed protein product [Rattus norvegicus]
GI:157951743 GenBank AAC53573.1 260 steroid dehydrogenase [Mus musculus]
GI:157951743 GenBank AAC69902.1 266 KE6a [Mus musculus]
GI:157951743 GenBank AGX53512.1 259 Sequence 7393 from patent US 8541208
GI:157951743 RefSeq NP_997694.1 259 estradiol 17-beta-dehydrogenase 8 [Rattus norvegicus]