Gene/Proteome Database (LMPD)
LMPD ID
LMP002745
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Gene Symbol
Synonyms
AI326997; BB173635; ST2B1; SULT2B
Alternate Names
sulfotransferase family cytosolic 2B member 1; sulfotransferase 2B; sulfotransferase 2B1; alcohol sulfotransferase; hydroxysteroid sulfotransferase 2
Chromosome
7
Map Location
7 B4|7
EC Number
2.8.2.2
Proteins
sulfotransferase family cytosolic 2B member 1 | |
---|---|
Refseq ID | NP_059493 |
Protein GI | 229092371 |
UniProt ID | O35400 |
mRNA ID | NM_017465 |
Length | 338 |
RefSeq Status | VALIDATED |
MDGPQPRALWSSSEKNVSEMSWNFGGEYFRYKGIPFPVGMYSPESLSLAENTSNVRDDDIFIVTYPKSGTNWMIEIVCLILKDGDPSWIRSEPIWQRAPWCETIISAFNVLDRPSPRIMSSHLPIELFTKAFFSSKAKVIYVGRNPRDVVVSLYYYSKIAGQLKDPGTPDQFLQNFLKGEVQFGSWFDHIKGWIRMQNQENFLFITYEELQQDLRGSVQRICEFLGRPLGEEALSSVVAHSAFAAMKANTMSNYSLLPASLLDHRQGEFLRKGISGDWKNHFTVAQSEAFDSVYREQMHGVQRFPWDTSEEDSSPDGQPDPEPSPSPASDDPNPGSSQ |
Gene Information
Entrez Gene ID
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0004027 | IEA:UniProtKB-EC | F | alcohol sulfotransferase activity |
GO:0050294 | IEA:Ensembl | F | steroid sulfotransferase activity |
GO:0008146 | IDA:MGI | F | sulfotransferase activity |
GO:0008202 | IEA:UniProtKB-KW | P | steroid metabolic process |
GO:0000103 | IDA:MGI | P | sulfate assimilation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Protein Entry
ST2B1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=SULT2B1b, B; IsoId=O35400-1; Sequence=Displayed; Name=2; Synonyms=SULT2B1a, A; IsoId=O35400-2; Sequence=VSP_012511; Note=No experimental confirmation available.; |
Catalytic Activity | 3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate. |
Developmental Stage | Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo. {ECO:0000269|PubMed:12639899}. |
Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system. |
Similarity | Belongs to the sulfotransferase 1 family. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. Microsome {ECO:0000250}. |
Tissue Specificity | Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate. {ECO:0000269|PubMed:12639899, ECO:0000269|PubMed:9647753}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002745 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
229092371 | RefSeq | NP_059493 | 338 | sulfotransferase family cytosolic 2B member 1 |
Identical Sequences to LMP002745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229092371 | GenBank | AAH09811.1 | 338 | Sult2b1 protein [Mus musculus] |
GI:229092371 | GenBank | AAH09813.1 | 338 | Sulfotransferase family, cytosolic, 2B, member 1 [Mus musculus] |
GI:229092371 | GenBank | EDL22896.1 | 338 | sulfotransferase family, cytosolic, 2B, member 1 [Mus musculus] |
GI:229092371 | SwissProt | O35400.2 | 338 | RecName: Full=Sulfotransferase family cytosolic 2B member 1; Short=ST2B1; Short=Sulfotransferase 2B1; AltName: Full=Alcohol sulfotransferase; AltName: Full=Hydroxysteroid sulfotransferase 2 [Mus musculus] |
Related Sequences to LMP002745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229092371 | GenBank | AAC69918.1 | 338 | hydroxysteroid sulfotransferase [Mus musculus] |
GI:229092371 | GenBank | AAM46788.1 | 372 | cytosolic sulfotransferase [Mus musculus] |
GI:229092371 | RefSeq | XP_006541060.1 | 372 | PREDICTED: sulfotransferase family cytosolic 2B member 1 isoform X1 [Mus musculus] |
GI:229092371 | RefSeq | XP_006541061.1 | 334 | PREDICTED: sulfotransferase family cytosolic 2B member 1 isoform X2 [Mus musculus] |
GI:229092371 | RefSeq | XP_006541062.1 | 299 | PREDICTED: sulfotransferase family cytosolic 2B member 1 isoform X3 [Mus musculus] |
GI:229092371 | RefSeq | XP_006541063.1 | 441 | PREDICTED: sulfotransferase family cytosolic 2B member 1 isoform X4 [Mus musculus] |