Gene/Proteome Database (LMPD)

LMPD ID
LMP002910
Gene ID
18476
Species
Mus musculus (Mouse)
Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 3
Gene Symbol
Pafah1b3
Synonyms
Pafahg; mus[g]
Chromosome
7
Map Location
7 A3|7

Proteins

platelet-activating factor acetylhydrolase IB subunit gamma
Refseq ID NP_032802
Protein GI 6679201
UniProt ID Q3TJC2
mRNA ID NM_008776
Length 232
RefSeq Status VALIDATED
MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAS

Gene Information

Entrez Gene ID
18476
Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 3
Gene Symbol
Pafah1b3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016020 IEA:Ensembl C membrane
GO:0003847 IEA:UniProtKB-EC F 1-alkyl-2-acetylglycerophosphocholine esterase activity
GO:0016787 IEA:UniProtKB-KW F hydrolase activity
GO:0007420 IEA:Ensembl P brain development
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0007283 IMP:MGI P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko00565 Ether lipid metabolism
mmu00565 Ether lipid metabolism
mmu01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR013831 SGNH_hydro-type_esterase_dom

UniProt Annotations

Entry Information

Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 3
Protein Entry
PA1B3_MOUSE
UniProt ID
Q3TJC2
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate.
Developmental Stage Expressed already by the time of neurulation. By E10.5, expression is abundant in the developing central and peripheral nervous systems. Major sites include the neuroepithelium of the fore-, mid-, and hindbrain, the spinal cord, the dorsal root, and cranial ganglia. In adult brain, expression is greatly diminished.
Function Inactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain.
Interaction P63005:Pafah1b1; NbExp=2; IntAct=EBI-1007637, EBI-917499;
Similarity Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma). The catalytic activity of the enzyme resides in the beta and gamma subunits, whereas the alpha subunit has regulatory activity. Trimer formation is not essential for the catalytic activity.

Identical and Related Proteins

Unique RefSeq proteins for LMP002910 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6679201 RefSeq NP_032802 232 platelet-activating factor acetylhydrolase IB subunit gamma

Identical Sequences to LMP002910 proteins

Reference Database Accession Length Protein Name
GI:6679201 DBBJ BAE32671.1 232 unnamed protein product [Mus musculus]
GI:6679201 DBBJ BAE39573.1 232 unnamed protein product [Mus musculus]
GI:6679201 GenBank EDL24278.1 232 platelet-activating factor acetylhydrolase, isoform 1b, alpha1 subunit, isoform CRA_a [Mus musculus]
GI:6679201 GenBank AEU43475.1 232 Sequence 224 from patent US 8052970
GI:6679201 GenBank AEU43518.1 232 Sequence 267 from patent US 8052970
GI:6679201 GenBank AEU43538.1 232 Sequence 287 from patent US 8052970

Related Sequences to LMP002910 proteins

Reference Database Accession Length Protein Name
GI:6679201 GenBank AAC27973.1 232 platelet-activating factor acetylhydrolase alpha 1 subunit [Rattus norvegicus]
GI:6679201 GenBank AAE64274.1 232 Sequence 38 from patent US 6146868
GI:6679201 GenBank EDM08032.1 232 platelet-activating factor acetylhydrolase, isoform 1b, alpha1 subunit, isoform CRA_a [Rattus norvegicus]
GI:6679201 RefSeq NP_446106.1 232 platelet-activating factor acetylhydrolase IB subunit gamma [Rattus norvegicus]
GI:6679201 RefSeq XP_006228427.1 232 PREDICTED: platelet-activating factor acetylhydrolase IB subunit gamma isoform X1 [Rattus norvegicus]
GI:6679201 SwissProt O35263.1 232 RecName: Full=Platelet-activating factor acetylhydrolase IB subunit gamma; AltName: Full=PAF acetylhydrolase 29 kDa subunit; Short=PAF-AH 29 kDa subunit; AltName: Full=PAF-AH subunit gamma; Short=PAFAH subunit gamma; AltName: Full=Platelet-activating factor acetylhydrolase alpha 1 subunit; Short=PAF-AH alpha 1 [Rattus norvegicus]