Gene/Proteome Database (LMPD)
LMPD ID
LMP002911
Gene ID
Species
Mus musculus (Mouse)
Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 2
Gene Symbol
Synonyms
AI747451; AU021353; Pafahb; mus[b]
Alternate Names
platelet-activating factor acetylhydrolase IB subunit beta; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF acetylhydrolase 30 kDa subunit; platelet-activating factor acetylhydrolase, isoform 1b, alpha2 subunit
Chromosome
9
Map Location
9 A5.2|9
EC Number
3.1.1.47
Proteins
| platelet-activating factor acetylhydrolase IB subunit beta | |
|---|---|
| Refseq ID | NP_032801 |
| Protein GI | 40254624 |
| UniProt ID | Q61206 |
| mRNA ID | NM_008775 |
| Length | 229 |
| RefSeq Status | PROVISIONAL |
| MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA | |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:MGI | C | cytoplasm |
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005730 | IEA:Ensembl | C | nucleolus |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0003847 | IEA:UniProtKB-EC | F | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| GO:0007420 | IEA:Ensembl | P | brain development |
| GO:0006928 | TAS:ProtInc | P | cellular component movement |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0016239 | IEA:Ensembl | P | positive regulation of macroautophagy |
| GO:0007283 | IMP:MGI | P | spermatogenesis |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013831 | SGNH_hydro-type_esterase_dom |
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase, isoform 1b, subunit 2
Protein Entry
PA1B2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate. |
| Developmental Stage | Expressed already by the time of neurulation. By E10.5, expression is abundant in the developing central and peripheral nervous systems. Major sites include the neuroepithelium of the fore-, mid-, and hindbrain, the spinal cord, the dorsal root, and cranial ganglia. |
| Function | Inactivates PAF by removing the acetyl group at the sn-2 position. This is a catalytic subunit. |
| Interaction | O35685:Nudc; NbExp=2; IntAct=EBI-7445518, EBI-911192; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. |
| Subunit | Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma). The catalytic activity of the enzyme resides in the beta and gamma subunits, whereas the alpha subunit has regulatory activity. Trimer formation is not essential for the catalytic activity. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002911 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 40254624 | RefSeq | NP_032801 | 229 | platelet-activating factor acetylhydrolase IB subunit beta |
Identical Sequences to LMP002911 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40254624 | GenBank | AEU43517.1 | 229 | Sequence 266 from patent US 8052970 |
| GI:40254624 | RefSeq | XP_006243019.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
| GI:40254624 | RefSeq | XP_006243020.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
| GI:40254624 | RefSeq | XP_006510147.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X4 [Mus musculus] |
| GI:40254624 | RefSeq | XP_006510148.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X5 [Mus musculus] |
| GI:40254624 | RefSeq | XP_008764394.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
Related Sequences to LMP002911 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40254624 | DBBJ | BAA19917.1 | 229 | acetylhydrolase IB beta-subunit [Homo sapiens] |
| GI:40254624 | GenBank | ACH97054.1 | 229 | platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (predicted) [Otolemur garnettii] |
| GI:40254624 | RefSeq | XP_006510144.1 | 242 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Mus musculus] |
| GI:40254624 | RefSeq | XP_006510145.1 | 237 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X2 [Mus musculus] |
| GI:40254624 | RefSeq | XP_006510146.1 | 232 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X3 [Mus musculus] |
| GI:40254624 | RefSeq | XP_007934691.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Orycteropus afer afer] |