Gene/Proteome Database (LMPD)
LMPD ID
LMP003617
Gene ID
Species
Mus musculus (Mouse)
Gene Name
Pigy upstream reading frame
Gene Symbol
Synonyms
2610022G08Rik; AI847956; Prey
Alternate Names
protein preY, mitochondrial; pre-Y homolog
Chromosome
6
Map Location
6 B3|6
Summary
This gene encodes a small protein with a conserved DUF343 domain. The human ortholog of this gene expresses two distinct proteins from upstream and downstream coding regions. The upstream CDS encoding a DUF343 domain-containing protein has been conserved at this mouse locus, but the downstream CDS encoding a subunit of an enzyme involved in glycosylphosphatidylinositol biosynthesis has not been conserved. Instead, a separate locus on mouse chromosome 9 encodes the mouse homolog of the human phosphatidylinositol glycan anchor biosynthesis, class Y protein. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| protein preY, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_079850 |
| Protein GI | 21313456 |
| UniProt ID | Q9D1C3 |
| mRNA ID | NM_025574 |
| Length | 112 |
| RefSeq Status | VALIDATED |
| MLSATCRRLAPALRRLRALSAVAGRFLQVPGARLCSDQSERAEQPHTFHPALLQFLVCPLSKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAARTTRQNEKQEEAEQP | |
| transit_peptide: 1..34 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9D1C3.1) calculated_mol_wt: 3693 peptide sequence: MLSATCRRLAPALRRLRALSAVAGRFLQVPGARL mat_peptide: 35..112 product: Protein preY, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D1C3.1) calculated_mol_wt: 8832 peptide sequence: CSDQSERAEQPHTFHPALLQFLVCPLSKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAARTTRQNEKQEEAEQP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | ISS:HGNC | C | endoplasmic reticulum membrane |
| GO:0000506 | ISS:HGNC | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005886 | ISA:MGI | C | plasma membrane |
| GO:0006506 | ISS:HGNC | P | GPI anchor biosynthetic process |
| GO:0009893 | ISS:HGNC | P | positive regulation of metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005651 | Uncharacterised protein family UPF0434/Trm112 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the PREY family. {ECO:0000305}. |
| Similarity | Contains 1 TRM112 domain. {ECO:0000305}. |
| Subcellular Location | Mitochondrion {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003617 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21313456 | RefSeq | NP_079850 | 112 | protein preY, mitochondrial precursor |
Identical Sequences to LMP003617 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313456 | DBBJ | BAB22953.1 | 112 | unnamed protein product [Mus musculus] |
| GI:21313456 | DBBJ | BAC26342.1 | 112 | unnamed protein product [Mus musculus] |
| GI:21313456 | DBBJ | BAC27846.1 | 112 | unnamed protein product [Mus musculus] |
| GI:21313456 | GenBank | AAH29232.1 | 112 | Phosphatidylinositol glycan anchor biosynthesis, class Y [Mus musculus] |
| GI:21313456 | SwissProt | Q9D1C3.1 | 112 | RecName: Full=Protein preY, mitochondrial; Flags: Precursor [Mus musculus] |
Related Sequences to LMP003617 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313456 | GenBank | AAH86361.1 | 112 | Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus] |
| GI:21313456 | GenBank | EDL04742.1 | 115 | phosphatidylinositol glycan anchor biosynthesis, class Y, isoform CRA_a, partial [Mus musculus] |
| GI:21313456 | GenBank | EDL04743.1 | 114 | phosphatidylinositol glycan anchor biosynthesis, class Y, isoform CRA_b, partial [Mus musculus] |
| GI:21313456 | GenBank | EDL88035.1 | 112 | similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus] |
| GI:21313456 | RefSeq | XP_005076103.1 | 112 | PREDICTED: protein preY, mitochondrial-like [Mesocricetus auratus] |
| GI:21313456 | RefSeq | XP_006992063.1 | 112 | PREDICTED: protein preY, mitochondrial-like [Peromyscus maniculatus bairdii] |