Gene/Proteome Database (LMPD)

LMPD ID
LMP003846
Gene ID
67103
Species
Mus musculus (Mouse)
Gene Name
prostaglandin reductase 1
Gene Symbol
Ptgr1
Synonyms
2510002C21Rik; Ltb4dh; Zadh3
Alternate Names
prostaglandin reductase 1; PRG-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase
Chromosome
4
Map Location
4|4 C1
EC Number
1.3.1.-

Proteins

prostaglandin reductase 1
Refseq ID NP_080244
Protein GI 13385466
UniProt ID Q91YR9
mRNA ID NM_025968
Length 329
RefSeq Status PROVISIONAL
MVQAKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMMGEQVARVVESKNSAFPKGTIVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVKGGETVMVSAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVRQKALTELMNWVSEGKVQCHEYVTEGFEKMPAAFMGMLKGENLGKTIVKA

Gene Information

Entrez Gene ID
67103
Gene Name
prostaglandin reductase 1
Gene Symbol
Ptgr1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0036132 IEA:UniProtKB-EC F 13-prostaglandin reductase activity
GO:0047522 IEA:UniProtKB-EC F 15-oxoprostaglandin 13-oxidase activity
GO:0032440 IEA:UniProtKB-EC F 2-alkenal reductase [NAD(P)] activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0009636 IEA:Ensembl P response to toxic substance

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-11470 sphingosine and sphingosine-1-phosphate metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893593 Synthesis of Leukotrienes (LT) and Eoxins (EX)
5894063 Synthesis of Lipoxins (LX)
5893002 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR002085 Alcohol dehydrogenase superfamily, zinc-type
IPR013149 Alcohol dehydrogenase, C-terminal
IPR011032 GroES (chaperonin 10)-like
IPR014190 Leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
prostaglandin reductase 1
Protein Entry
PTGR1_MOUSE
UniProt ID
Q91YR9
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)(+) = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13- dienoate + NAD(P)H.
Catalytic Activity A n-alkanal + NAD(P)(+) = an alk-2-enal + NAD(P)H.
Function Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12- oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4 (By similarity). {ECO:0000250}.
Similarity Belongs to the NADP-dependent oxidoreductase L4BD family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.
Subunit Monomer or homodimer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003846 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13385466 RefSeq NP_080244 329 prostaglandin reductase 1

Identical Sequences to LMP003846 proteins

Reference Database Accession Length Protein Name
GI:13385466 DBBJ BAB27941.1 329 unnamed protein product [Mus musculus]
GI:13385466 DBBJ BAC29060.1 329 unnamed protein product [Mus musculus]
GI:13385466 DBBJ BAE22145.1 329 unnamed protein product [Mus musculus]
GI:13385466 DBBJ BAE39057.1 329 unnamed protein product [Mus musculus]
GI:13385466 GenBank EDL02217.1 329 leukotriene B4 12-hydroxydehydrogenase [Mus musculus]
GI:13385466 SwissProt Q91YR9.2 329 RecName: Full=Prostaglandin reductase 1; Short=PRG-1; AltName: Full=15-oxoprostaglandin 13-reductase; AltName: Full=NADP-dependent leukotriene B4 12-hydroxydehydrogenase [Mus musculus]

Related Sequences to LMP003846 proteins

Reference Database Accession Length Protein Name
GI:13385466 EMBL CAJ18475.1 329 Ltb4dh [Mus musculus]
GI:13385466 GenBank AAB88912.2 329 dithiolethione-inducible gene-1 [Rattus norvegicus]
GI:13385466 GenBank AAH14865.1 329 Prostaglandin reductase 1 [Mus musculus]
GI:13385466 GenBank AAH89775.1 329 Prostaglandin reductase 1 [Rattus norvegicus]
GI:13385466 RefSeq NP_620218.1 329 prostaglandin reductase 1 [Rattus norvegicus]
GI:13385466 SwissProt P97584.3 329 RecName: Full=Prostaglandin reductase 1; Short=PRG-1; AltName: Full=15-oxoprostaglandin 13-reductase; AltName: Full=Dithiolethione-inducible gene 1 protein; Short=D3T-inducible gene 1 protein; Short=DIG-1; AltName: Full=NADP-dependent leukotriene B4 12-hydroxydehydrogenase [Rattus norvegicus]