Gene/Proteome Database (LMPD)
LMPD ID
LMP004460
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol transfer protein, cytoplasmic 1
Gene Symbol
Synonyms
1110020B03Rik; 5830436L09Rik; AI662802; AI851387; C330017I21Rik; Dnr411; RDGBB; RDGBB1; rdgB-beta
Alternate Names
cytoplasmic phosphatidylinositol transfer protein 1; rdgBbeta; mrdgBbeta; M-rdgB beta; mM-rdgBbeta; mammalian rdgB homolog beta; retinal degeneration B beta; retinal degeneration B homolog beta; diabetic nephropathy-related protein
Chromosome
11
Map Location
11 E1|11
Proteins
cytoplasmic phosphatidylinositol transfer protein 1 | |
---|---|
Refseq ID | NP_665822 |
Protein GI | 22003862 |
UniProt ID | Q8K4R4 |
mRNA ID | NM_145823 |
Length | 268 |
RefSeq Status | PROVISIONAL |
MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDNHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDVREYEKNMHEQTNIKVCNQHSSTVDDIESHAQTST |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, cytoplasmic 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | ISS:UniProtKB | C | cytoplasm |
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0008526 | ISS:UniProtKB | F | phosphatidylinositol transporter activity |
GO:0007165 | ISS:UniProtKB | P | signal transduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, cytoplasmic 1
Protein Entry
PITC1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=mM-rdgBbeta; IsoId=Q8K4R4-1; Sequence=Displayed; Note=No experimental confirmation available.; Name=2; Synonyms=mM-rdgBbeta1; IsoId=Q8K4R4-2; Sequence=VSP_025549, VSP_025551; Name=3; IsoId=Q8K4R4-3; Sequence=VSP_025548, VSP_025550; Note=No experimental confirmation available.; Name=4; IsoId=Q8K4R4-4; Sequence=VSP_025546, VSP_025547; Note=No experimental confirmation available.; |
Function | Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro. Isoform 2 specifically binds to phosphatidylinositol but not to other phospholipids and may play a role in the phosphoinositide-mediated signaling in the neural development. {ECO:0000269|PubMed:12562526}. |
Sequence Caution | Sequence=CAM17314.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAM17315.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAM20627.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAM25441.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAM25442.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the PtdIns transfer protein family. PI transfer class IIB subfamily. {ECO:0000305}. |
Subcellular Location | Isoform 1: Cytoplasm. |
Subcellular Location | Isoform 2: Cytoplasm. Nucleus. |
Tissue Specificity | Isoform 1 is widely expressed. Isoform 2 is weakly expressed. In brain, isoform 2 is weakly expressed and is rather confined to the embryonic stage. In contrast, isoform 1 is widely expressed in brain, with expression in the gray matters of pre- and postnatal brains. {ECO:0000269|PubMed:12562526}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004460 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
22003862 | RefSeq | NP_665822 | 268 | cytoplasmic phosphatidylinositol transfer protein 1 |
Identical Sequences to LMP004460 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22003862 | DBBJ | BAC02913.1 | 268 | splicing variant of retinal degeneration B beta [Mus musculus] |
GI:22003862 | GenBank | AAI08352.1 | 268 | Phosphatidylinositol transfer protein, cytoplasmic 1 [Mus musculus] |
Related Sequences to LMP004460 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22003862 | RefSeq | XP_003913377.1 | 268 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X5 [Papio anubis] |
GI:22003862 | RefSeq | XP_005350489.1 | 268 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X2 [Microtus ochrogaster] |
GI:22003862 | RefSeq | XP_005328283.1 | 268 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X2 [Ictidomys tridecemlineatus] |
GI:22003862 | RefSeq | XP_006220943.1 | 268 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X3 [Rattus norvegicus] |
GI:22003862 | RefSeq | XP_008010213.1 | 268 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X9 [Chlorocebus sabaeus] |
GI:22003862 | RefSeq | XP_008773641.1 | 366 | PREDICTED: cytoplasmic phosphatidylinositol transfer protein 1 isoform X1 [Rattus norvegicus] |