Gene/Proteome Database (LMPD)

LMPD ID
LMP005609
Gene ID
100017
Species
Mus musculus (Mouse)
Gene Name
low density lipoprotein receptor adaptor protein 1
Gene Symbol
Ldlrap1
Synonyms
AA691260; ARH2; Arh; Arh1; FHCB1; FHCB2
Alternate Names
low density lipoprotein receptor adapter protein 1; LDL receptor adaptor protein; autosomal recessive hypercholesterolemia protein homolog
Chromosome
4
Map Location
4 D3|4

Proteins

low density lipoprotein receptor adapter protein 1
Refseq ID NP_663529
Protein GI 160333775
UniProt ID Q8C142
mRNA ID NM_145554
Length 308
RefSeq Status VALIDATED
MDALKSAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGGDVPGTRRDSTPSLKTLVATGNLLDLEEVAKAPLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLSAQDIHYAQCLSPTDWDKPDSSGIDQDDDVFTF

Gene Information

Entrez Gene ID
100017
Gene Name
low density lipoprotein receptor adaptor protein 1
Gene Symbol
Ldlrap1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030121 IEA:Ensembl C AP-1 adaptor complex
GO:0030122 IEA:Ensembl C AP-2 adaptor complex
GO:0030424 IEA:Ensembl C axon
GO:0009925 ISS:UniProtKB C basal plasma membrane
GO:0005737 IDA:BHF-UCL C cytoplasm
GO:0009898 IEA:Ensembl C cytoplasmic side of plasma membrane
GO:0005829 ISS:UniProtKB C cytosol
GO:0005769 IDA:MGI C early endosome
GO:0005883 IDA:BHF-UCL C neurofilament
GO:0055037 IEA:Ensembl C recycling endosome
GO:0001540 IPI:BHF-UCL F beta-amyloid binding
GO:0030276 ISS:UniProtKB F clathrin binding
GO:0005546 IEA:Ensembl F phosphatidylinositol-4,5-bisphosphate binding
GO:0001784 ISS:UniProtKB F phosphotyrosine binding
GO:0005102 ISA:MGI F receptor binding
GO:0035591 IEA:Ensembl F signaling adaptor activity
GO:0042982 IEA:Ensembl P amyloid precursor protein metabolic process
GO:0042632 IMP:MGI P cholesterol homeostasis
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process
GO:0048260 ISS:UniProtKB P positive regulation of receptor-mediated endocytosis
GO:0031623 IEA:Ensembl P receptor internalization
GO:0090118 IEA:Ensembl P receptor-mediated endocytosis of low-density lipoprotein particle involved in cholesterol transport
GO:0090003 IEA:Ensembl P regulation of establishment of protein localization to plasma membrane
GO:0043393 IEA:Ensembl P regulation of protein binding

KEGG Pathway Links

KEGG Pathway ID Description
ko04144 Endocytosis
mmu04144 Endocytosis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893389 Chylomicron-mediated lipid transport
5893345 LDL-mediated lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR006020 PTB/PI domain
IPR011993 Pleckstrin homology-like domain

UniProt Annotations

Entry Information

Gene Name
low density lipoprotein receptor adaptor protein 1
Protein Entry
ARH_MOUSE
UniProt ID
Q8C142
Species
Mouse

Comments

Comment Type Description
Disruption Phenotype Mice are extremely sensitive to cholesterol intake. LDLR are expressed at normal levels, but are sequestered at the hepatocyte surface. LDL internalization defect is caused by the inability of the LDLR to enter the endocytic cycle. {ECO:0000269|PubMed:15166224}.
Domain The [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif mediates interaction the AP-2 complex subunit AP2B1. {ECO:0000250}.
Function Adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). May be required for LDL binding and internalization but not for receptor clustering in coated pits. May facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. May also be involved in the internalization of other LDLR family members. Binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface. {ECO:0000269|PubMed:12746448, ECO:0000269|PubMed:15166224}.
Sequence Caution Sequence=AAH21467.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Contains 1 PID domain. {ECO:0000255|PROSITE- ProRule:PRU00148}.
Subcellular Location Cytoplasm {ECO:0000269|PubMed:15166224}.
Subunit Interacts with LDLR. Binds to soluble clathrin trimers. Interacts with AP2B1; the interaction mediates the association with the AP-2 complex. Interacts with VLDLR. {ECO:0000269|PubMed:12746448}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005609 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
160333775 RefSeq NP_663529 308 low density lipoprotein receptor adapter protein 1

Identical Sequences to LMP005609 proteins

Reference Database Accession Length Protein Name
GI:160333775 DBBJ BAE39396.1 308 unnamed protein product [Mus musculus]
GI:160333775 DBBJ BAE28493.1 308 unnamed protein product [Mus musculus]
GI:160333775 DBBJ BAE35380.1 308 unnamed protein product [Mus musculus]
GI:160333775 GenBank AAN94105.1 308 Sequence 4 from patent US 6465196
GI:160333775 GenBank EDL30001.1 308 low density lipoprotein receptor adaptor protein 1 [Mus musculus]
GI:160333775 SwissProt Q8C142.3 308 RecName: Full=Low density lipoprotein receptor adapter protein 1; AltName: Full=Autosomal recessive hypercholesterolemia protein homolog [Mus musculus]

Related Sequences to LMP005609 proteins

Reference Database Accession Length Protein Name
GI:160333775 DBBJ BAC26238.1 308 unnamed protein product [Mus musculus]
GI:160333775 GenBank AAH66808.1 308 Ldlrap1 protein [Mus musculus]
GI:160333775 GenBank AAH67411.1 308 Ldlrap1 protein [Mus musculus]
GI:160333775 GenBank EDL80736.1 307 similar to LDL receptor adaptor protein (predicted) [Rattus norvegicus]
GI:160333775 RefSeq NP_001102741.1 307 low density lipoprotein receptor adapter protein 1 [Rattus norvegicus]
GI:160333775 RefSeq XP_005079648.1 307 PREDICTED: low density lipoprotein receptor adapter protein 1 [Mesocricetus auratus]