Gene/Proteome Database (LMPD)
LMPD ID
LMP005934
Gene ID
Species
Homo sapiens (Human)
Gene Name
coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Gene Symbol
Synonyms
-
Alternate Names
2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
Chromosome
12
Map Location
12q24.31
EC Number
2.1.1.201
Proteins
| 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_115690 |
| Protein GI | 116063536 |
| UniProt ID | Q5HYK3 |
| mRNA ID | NM_032314 |
| Length | 327 |
| RefSeq Status | VALIDATED |
| MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL | |
| transit_peptide: 1..49 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q5HYK3.2) calculated_mol_wt: 5355 peptide sequence: MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRA mat_peptide: 50..327 product: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5HYK3.2) calculated_mol_wt: 31803 peptide sequence: AETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL | |
Gene Information
Entrez Gene ID
Gene Name
coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0008168 | IEA:UniProtKB-KW | F | methyltransferase activity |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006744 | TAS:Reactome | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa01100 | Metabolic pathways |
| hsa00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_160111 | Ubiquinol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Protein Entry
COQ5_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q5HYK3-1; Sequence=Displayed; Name=2; IsoId=Q5HYK3-2; Sequence=VSP_017681, VSP_017682; Note=No experimental confirmation available.; |
| Catalytic Activity | S-adenosyl-L-methionine + 2-methoxy-6-all- trans-polyprenyl-1,4-benzoquinol = S-adenosyl-L-homocysteine + 6- methoxy-3-methyl-2-all-trans-polyprenyl-1,4-benzoquinol. |
| Function | Methyltransferase required for the conversion of 2- polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3- methyl-6-methoxy-1,4-benzoquinol (DMQH2). |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. UbiE family. |
| Subcellular Location | Mitochondrion . |
Identical and Related Proteins
Unique RefSeq proteins for LMP005934 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 116063536 | RefSeq | NP_115690 | 327 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial precursor |
Identical Sequences to LMP005934 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116063536 | DBBJ | BAG57105.1 | 327 | unnamed protein product [Homo sapiens] |
| GI:116063536 | DBBJ | BAJ21081.1 | 327 | coenzyme Q5 homolog, methyltransferase, partial [synthetic construct] |
| GI:116063536 | GenBank | AAI07875.1 | 327 | Coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [Homo sapiens] |
| GI:116063536 | GenBank | EAW98198.1 | 327 | coenzyme Q5 homolog, methyltransferase (yeast), isoform CRA_a [Homo sapiens] |
| GI:116063536 | GenBank | AIC57322.1 | 327 | COQ5, partial [synthetic construct] |
| GI:116063536 | SwissProt | Q5HYK3.2 | 327 | RecName: Full=2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; AltName: Full=Ubiquinone biosynthesis methyltransferase COQ5; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP005934 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116063536 | DBBJ | BAD96330.1 | 327 | hypothetical protein MGC4767 variant, partial [Homo sapiens] |
| GI:116063536 | EMBL | CAI46073.1 | 327 | hypothetical protein [Homo sapiens] |
| GI:116063536 | GenBank | AAH04916.2 | 325 | COQ5 protein, partial [Homo sapiens] |
| GI:116063536 | GenBank | ACD75052.1 | 327 | COQ5 [Homo sapiens] |
| GI:116063536 | GenBank | JAA02080.1 | 327 | coenzyme Q5 homolog, methyltransferase [Pan troglodytes] |
| GI:116063536 | RefSeq | XP_003832430.1 | 327 | PREDICTED: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial [Pan paniscus] |