Gene/Proteome Database (LMPD)
Proteins
| Bud32p | |
|---|---|
| Refseq ID | NP_011778 |
| Protein GI | 6321701 |
| UniProt ID | P53323 |
| mRNA ID | NM_001181391 |
| Length | 261 |
| RefSeq Status | PROVISIONAL |
| MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000408 | IDA:SGD | C | EKC/KEOPS complex |
| GO:0000781 | IEA:UniProtKB-KW | C | chromosome, telomeric region |
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0016020 | IEA:InterPro | C | membrane |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0016887 | ISS:UniProtKB | F | ATPase activity |
| GO:0004674 | IDA:SGD | F | protein serine/threonine kinase activity |
| GO:0006200 | ISS:GOC | P | ATP catabolic process |
| GO:0009103 | IEA:InterPro | P | lipopolysaccharide biosynthetic process |
| GO:0045944 | IPI:SGD | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0006468 | IDA:SGD | P | protein phosphorylation |
| GO:0008033 | IEA:UniProtKB-KW | P | tRNA processing |
| GO:0000723 | IMP:SGD | P | telomere maintenance |
| GO:0000722 | IMP:SGD | P | telomere maintenance via recombination |
| GO:0070525 | IMP:SGD | P | threonylcarbamoyladenosine metabolic process |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + a protein = ADP + a phosphoprotein. |
| Function | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Important for bud site selection. {ECO:0000269|PubMed:16564010, ECO:0000269|PubMed:16874308, ECO:0000269|PubMed:21183954, ECO:0000269|PubMed:21459853, ECO:0000269|PubMed:23258706, ECO:0000269|PubMed:23620299}. |
| Interaction | Q03705:CGI121; NbExp=8; IntAct=EBI-3809, EBI-912262; P46984:GON7; NbExp=6; IntAct=EBI-3809, EBI-26178; P32642:GRX4; NbExp=10; IntAct=EBI-3809, EBI-22211; P36132:KAE1; NbExp=20; IntAct=EBI-3809, EBI-26411; |
| Miscellaneous | Present with 3020 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Miscellaneous | This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (PubMed:12023889). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). {ECO:0000250, ECO:0000305|PubMed:12023889}. |
| Similarity | Belongs to the protein kinase superfamily. BUD32 family. {ECO:0000305}. |
| Similarity | Contains 1 protein kinase domain. {ECO:0000255|PROSITE-ProRule:PRU00159}. |
| Subcellular Location | Cytoplasm {ECO:0000269|PubMed:14562095}. Nucleus {ECO:0000269|PubMed:14562095}. Chromosome, telomere {ECO:0000269|PubMed:14562095}. |
| Subunit | Component of the EKC/KEOPS complex composed of at least BUD32, CGI121, GON7, KAE1 and PCC1; the whole complex dimerizes. {ECO:0000269|PubMed:16564010, ECO:0000269|PubMed:16874308}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006865 (as displayed in Record Overview)
Identical Sequences to LMP006865 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6321701 | GenBank | EIW10611.1 | 261 | Bud32p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6321701 | GenBank | EWG86122.1 | 261 | Bud32p [Saccharomyces cerevisiae R008] |
| GI:6321701 | GenBank | EWG91197.1 | 261 | Bud32p [Saccharomyces cerevisiae P301] |
| GI:6321701 | GenBank | EWG95760.1 | 261 | Bud32p [Saccharomyces cerevisiae R103] |
| GI:6321701 | GenBank | EWH18482.1 | 261 | Bud32p [Saccharomyces cerevisiae P283] |
| GI:6321701 | gnl | McCuskerlabDuke | 261 | Bud32p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP006865 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6321701 | EMBL | CCC70470.1 | 263 | hypothetical protein NCAS_0E04000 [Naumovozyma castellii CBS 4309] |
| GI:6321701 | GenBank | EGA62127.1 | 261 | Bud32p [Saccharomyces cerevisiae FostersO] |
| GI:6321701 | GenBank | EHN02208.1 | 261 | Bud32p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6321701 | GenBank | EJS43607.1 | 261 | bud32p [Saccharomyces arboricola H-6] |
| GI:6321701 | GenBank | EJT43190.1 | 261 | BUD32-like protein [Saccharomyces kudriavzevii IFO 1802] |
| GI:6321701 | RefSeq | XP_003676826.1 | 263 | hypothetical protein NCAS_0E04000 [Naumovozyma castellii CBS 4309] |