Gene/Proteome Database (LMPD)
Proteins
Bet2p | |
---|---|
Refseq ID | NP_015502 |
Protein GI | 6325434 |
UniProt ID | P20133 |
mRNA ID | NM_001184273 |
Length | 325 |
MSGSLTLLKEKHIRYIESLDTKKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAFAPFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILGELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGLNGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDNLVPIDPIYCMPKSVTSKFKKYPYK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005968 | IDA:SGD | C | Rab-protein geranylgeranyltransferase complex |
GO:0017137 | ISS:UniProtKB | F | Rab GTPase binding |
GO:0004663 | IDA:SGD | F | Rab geranylgeranyltransferase activity |
GO:0008270 | ISS:UniProtKB | F | zinc ion binding |
GO:0006888 | IMP:SGD | P | ER to Golgi vesicle-mediated transport |
GO:0018344 | IDA:SGD | P | protein geranylgeranylation |
GO:0006612 | IMP:SGD | P | protein targeting to membrane |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. |
Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence= ; Note=Binds 1 zinc ion per subunit. ; |
Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; |
Function | Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal -XCC or -XCXC, where both cysteines may become modified. Acts on YPT1 and SEC4. |
Interaction | Q00618:BET4; NbExp=3; IntAct=EBI-3559, EBI-3573; |
Miscellaneous | Present with 1520 molecules/cell in log phase SD medium |
Miscellaneous | Present with 1520 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the protein prenyltransferase subunit beta family |
Similarity | Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}. |
Similarity | Contains 6 PFTB repeats |
Similarity | Contains 6 PFTB repeats. {ECO:0000305}. |
Subunit | Heterodimer of an alpha and a beta subunit. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007024 (as displayed in Record Overview)
Identical Sequences to LMP007024 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007024 proteins
Reference | Database | Accession | Length | Protein Name |
---|