Gene/Proteome Database (LMPD)
Proteins
Hst4p | |
---|---|
Refseq ID | NP_010477 |
Protein GI | 398366029 |
UniProt ID | P53688 |
mRNA ID | NM_001180499 |
Length | 370 |
MKQKFVLPITPPSTAEKKPQTENRCNENLKPRRLLPQLKKSVRNRKPRLSYRPELNSVFDLDAYVDSTHLSKSQRHHMDRDAGFISYALNYSKRMVVVSGAGISVAAGIPDFRSSEGIFSTVNGGSGKDLFDYNRVYGDESMSLKFNQLMVSLFRLSKNCQPTKFHEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTVQLHGSIKHMECNKCLNIKPFDPELFKCDDKFDSRTEIIPSCPQCEEYETVRKMAGLRSTGVGKLRPRVILYNEVHPEGDFIGEIANNDLKKRIDCLIIVGTSLKIPGVKNICRQFAAKVHANRGIVLYLNTSMPPKNVLDSLKFVDLVVLGDCQHVTSLL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0003677 | ISS:SGD | F | DNA binding |
GO:0070403 | IEA:InterPro | F | NAD+ binding |
GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0006348 | IGI:SGD | P | chromatin silencing at telomere |
GO:0016575 | IMP:SGD | P | histone deacetylation |
GO:0046459 | IMP:SGD | P | short-chain fatty acid metabolic process |
GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | NAD(+) + an acetylprotein = nicotinamide + O- acetyl-ADP-ribose + a protein. {ECO:0000255|PROSITE- ProRule:PRU00236}. |
Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence= ; Note=Binds 1 zinc ion per subunit. ; |
Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; |
Function | NAD-dependent histone deacetylase, which contributes together with HST3 to histone H3 'Lys-56' deacetylation, regulation of telomeric silencing, proper cell cycle progression, DNA damage control, DNA recombination, and genomic maintenance. {ECO:0000269|PubMed:10841563, ECO:0000269|PubMed:16487579, ECO:0000269|PubMed:16815704, ECO:0000269|PubMed:17106263}. |
Miscellaneous | Present with 377 molecules/cell in log phase SD medium |
Miscellaneous | Present with 377 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the sirtuin family. Class I subfamily |
Similarity | Belongs to the sirtuin family. Class I subfamily. {ECO:0000305}. |
Similarity | Contains 1 deacetylase sirtuin-type domain |
Similarity | Contains 1 deacetylase sirtuin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00236}. |
Subcellular Location | Nucleus {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:17106263}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007147 (as displayed in Record Overview)
Identical Sequences to LMP007147 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007147 proteins
Reference | Database | Accession | Length | Protein Name |
---|