Gene/Proteome Database (LMPD)
Proteins
Yah1p | |
---|---|
Refseq ID | NP_015071 |
Protein GI | 6325004 |
UniProt ID | Q12184 |
mRNA ID | NM_001184066 |
Length | 172 |
MLKIVTRAGHTARISNIAAHLLRTSPSLLTRTTTTTRFLPFSTSSFLNHGHLKKPKPGEELKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005759 | IDA:UniProtKB | C | mitochondrial matrix |
GO:0051537 | IEA:InterPro | F | 2 iron, 2 sulfur cluster binding |
GO:0009055 | NAS:UniProtKB | F | electron carrier activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0006784 | IMP:SGD | P | heme a biosynthetic process |
GO:0016226 | IDA:UniProtKB | P | iron-sulfur cluster assembly |
GO:0055114 | IEA:UniProtKB-KW | P | oxidation-reduction process |
GO:0006744 | IMP:SGD | P | ubiquinone biosynthetic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-7235 | superpathway of ubiquinol-6 biosynthesis |
PWY-7230 | ubiquinol-6 biosynthesis from 4-aminobenzoate |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000250}; Note=Binds 1 [2Fe-2S] cluster. {ECO:0000250}; |
Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence= ; Note=Binds 1 [2Fe-2S] cluster. ; |
Function | Required for Fe-S cluster incorporation into mitochondrial and cytosolic apoproteins. May be part of a novel electron transport chain |
Function | Required for Fe-S cluster incorporation into mitochondrial and cytosolic apoproteins. May be part of a novel electron transport chain. {ECO:0000269|PubMed:10655482}. |
Miscellaneous | Present with 14800 molecules/cell in log phase SD medium |
Miscellaneous | Present with 14800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the adrenodoxin/putidaredoxin family |
Similarity | Belongs to the adrenodoxin/putidaredoxin family. {ECO:0000305}. |
Similarity | Contains 1 2Fe-2S ferredoxin-type domain |
Similarity | Contains 1 2Fe-2S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00465}. |
Subcellular Location | Mitochondrion matrix . |
Subcellular Location | Mitochondrion matrix {ECO:0000269|PubMed:10375636, ECO:0000269|PubMed:10655482}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007252 (as displayed in Record Overview)
Identical Sequences to LMP007252 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007252 proteins
Reference | Database | Accession | Length | Protein Name |
---|