Gene/Proteome Database (LMPD)
Proteins
profilin | |
---|---|
Refseq ID | NP_014765 |
Protein GI | 398365245 |
UniProt ID | P07274 |
mRNA ID | NM_001183541 |
Length | 126 |
MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005856 | IEA:UniProtKB-KW | C | cytoskeleton |
GO:0005829 | IDA:SGD | C | cytosol |
GO:0019897 | IDA:SGD | C | extrinsic component of plasma membrane |
GO:0003785 | IDA:SGD | F | actin monomer binding |
GO:0005546 | IDA:SGD | F | phosphatidylinositol-4,5-bisphosphate binding |
GO:0070064 | IDA:SGD | F | proline-rich region binding |
GO:0030036 | IEA:InterPro | P | actin cytoskeleton organization |
GO:0046907 | IGI:SGD | P | intracellular transport |
GO:0090338 | IDA:SGD | P | positive regulation of formin-nucleated actin cable assembly |
GO:0042989 | IDA:SGD | P | sequestering of actin monomers |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. |
Interaction | Q9VEX9:Bin1 (xeno); NbExp=3; IntAct=EBI-13892, EBI-129424; |
Similarity | Belongs to the profilin family |
Similarity | Belongs to the profilin family. {ECO:0000305}. |
Subcellular Location | Cytoplasm, cytoskeleton. |
Subunit | Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007423 (as displayed in Record Overview)
Identical Sequences to LMP007423 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007423 proteins
Reference | Database | Accession | Length | Protein Name |
---|