Gene/Proteome Database (LMPD)
LMPD ID
LMP007684
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Gene Symbol
Synonyms
ECK3436; JW3417; psiB; psiC
Summary
Pho regulon. [More information is available at EcoGene: EG11046]. The UgpABCE glycerol-3-phosphate uptake system is a member of the ATP-Binding Cassette (ABC) Superfamily . [More information is available at EcoCyc: EG11046].
Orthologs
Proteins
| sn-glycerol-3-phosphate ABC transporter permease [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_417909 |
| Protein GI | 16131324 |
| UniProt ID | P10905 |
| Length | 295 |
| RefSeq Status | REVIEWED |
| MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFVTLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSGGPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ | |
Gene Information
Entrez Gene ID
Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0055052 | IDA:EcoCyc | C | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
| GO:0015169 | IMP:EcoCyc | F | glycerol-3-phosphate transmembrane transporter activity |
| GO:0001406 | IDA:EcoCyc | F | glycerophosphodiester transmembrane transporter activity |
| GO:0015794 | IMP:EcoCyc | P | glycerol-3-phosphate transport |
| GO:0001407 | IDA:EcoCyc | P | glycerophosphodiester transport |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco02010 | ABC transporters |
| ko02010 | ABC transporters |
| M00198 | Putative sn-glycerol-phosphate transport system |
| eco_M00198 | Putative sn-glycerol-phosphate transport system |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000515 | MetI-like |
UniProt Annotations
Entry Information
Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Protein Entry
UGPA_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Function | Part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate; probably responsible for the translocation of the substrate across the membrane. |
| Similarity | Belongs to the binding-protein-dependent transport system permease family. UgpAE subfamily. {ECO:0000305}. |
| Similarity | Contains 1 ABC transmembrane type-1 domain. {ECO:0000255|PROSITE-ProRule:PRU00441}. |
| Subcellular Location | Cell inner membrane; Multi-pass membrane protein. |
| Subunit | The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute- binding protein (UgpB). {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007684 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131324 | RefSeq | NP_417909 | 295 | sn-glycerol-3-phosphate ABC transporter permease [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007684 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131324 | GenBank | KHI69788.1 | 295 | glycerol-3-phosphate transporter permease [Escherichia coli] |
| GI:16131324 | GenBank | KHI75771.1 | 295 | glycerol-3-phosphate transporter permease [Escherichia coli] |
| GI:16131324 | GenBank | KHI98956.1 | 295 | glycerol-3-phosphate transporter permease [Escherichia coli] |
| GI:16131324 | GenBank | KHJ00537.1 | 295 | glycerol-3-phosphate transporter permease [Escherichia coli] |
| GI:16131324 | GenBank | KHJ08136.1 | 295 | glycerol-3-phosphate transporter permease [Escherichia coli] |
| GI:16131324 | gnl | IGS | 295 | glycerol-3-phosphate transporter subunit [Escherichia coli ER2796] |
Related Sequences to LMP007684 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131324 | GenBank | AAP19253.1 | 295 | sn-glycerol 3-phosphate transport protein, integral membrane protein [Shigella flexneri 2a str. 2457T] |
| GI:16131324 | GenBank | EID63735.1 | 295 | glycerol-3-phosphate transporter permease [Shigella flexneri 5a str. M90T] |
| GI:16131324 | GenBank | EIQ54699.1 | 295 | binding--dependent transport system inner membrane component family protein [Shigella flexneri 1235-66] |
| GI:16131324 | GenBank | EJL10071.1 | 295 | ugpA [Shigella flexneri 6603-63] |
| GI:16131324 | RefSeq | NP_839442.1 | 295 | glycerol-3-phosphate transporter permease [Shigella flexneri 2a str. 2457T] |
| GI:16131324 | RefSeq | YP_005729077.1 | 295 | sn-glycerol-3-phosphate transport system permease protein ugpA [Shigella flexneri 2002017] |