Gene/Proteome Database (LMPD)
LMPD ID
LMP007700
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Gene Symbol
Synonyms
ECK2305; JW2308; dedF
Summary
Genetic interactions between ubiX and ubiG as well as their mutant phenotypes indicate that UbiX and UbiG must interact to be able to carry out the 3-octaprenyl-4-hydroxybenzoate decarboxylase step in ubiquinone biosynthesis during logarithmic growth. [More information is available at EcoCyc: EG11044].
Orthologs
Proteins
| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416814 |
| Protein GI | 16130246 |
| UniProt ID | P0AG03 |
| Length | 189 |
| RefSeq Status | REVIEWED |
| MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALADVTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPEDLFARWQGA | |
Gene Information
Entrez Gene ID
Gene Name
3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008694 | IGI:EcoCyc | F | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase activity |
| GO:0006744 | IGI:EcoCyc | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco01110 | Biosynthesis of secondary metabolites |
| eco01100 | Metabolic pathways |
| eco00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| ko00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| M00117 | Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone |
| eco_M00117 | Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| ALL-CHORISMATE-PWY | superpathway of chorismate metabolism |
| ALL-CHORISMATE-PWY | superpathway of chorismate metabolism |
| UBISYN-PWY | superpathway of ubiquinol-8 biosynthesis (prokaryotic) |
| UBISYN-PWY | superpathway of ubiquinol-8 biosynthesis (prokaryotic) |
| PWY-6708 | ubiquinol-8 biosynthesis (prokaryotic) |
| UBISYN-PWY | ubiquinol-8 biosynthesis (prokaryotic) |
| PWY-6708 | ubiquinol-8 biosynthesis (prokaryotic) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Protein Entry
UBIX_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=FMN; Xref=ChEBI:CHEBI:58210; Evidence={ECO:0000250}; Note=Binds 1 FMN per subunit. {ECO:0000250}; |
| Disruption Phenotype | Cells lacking this gene produce very low levels of coenzyme Q(8) during logarithmic growth, grow slowly on succinate as the sole carbon source, accumulate 4-hydroxy-3- octaprenyl-benzoate, and have reduced UbiG O-methyltransferase activity. In contrast, they synthesize near normal levels of Q(8) in the stationary phase. {ECO:0000269|PubMed:17889824}. |
| Function | Acts in concert with UbiD to perform the decarboxylation of 4-hydroxy-3-octaprenyl-benzoate, a step in the biosynthesis of coenzyme Q. Nevertheless, it is not clear how UbiX and UbiD act together and if UbiX has itself a decarboxylase activity. UbiX may function to deliver the substrate to its UbiD partner, which performs the decarboxylation step. {ECO:0000269|PubMed:16923914, ECO:0000269|PubMed:17889824}. |
| Induction | During aerobic growth, expression depends on the carbon source, with the highest expression on succinate, a median expression on glycerol, and the lowest on glucose. During anaerobic growth, glucose does not inhibit expression. {ECO:0000269|PubMed:12799002}. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the polyprenyl p-hydroxybenzoate / phenylacrylic acid decarboxylases family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007700 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16130246 | RefSeq | NP_416814 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16130246 | GenBank | KHI66945.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli] |
| GI:16130246 | GenBank | KHI74450.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli] |
| GI:16130246 | GenBank | KHI78660.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli] |
| GI:16130246 | GenBank | KHI96179.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli] |
| GI:16130246 | GenBank | KHJ14640.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli] |
| GI:16130246 | gnl | IGS | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli ER2796] |
Related Sequences to LMP007700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16130246 | GenBank | EHG00540.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli cloneA_i1] |
| GI:16130246 | GenBank | EHN99074.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli H397] |
| GI:16130246 | GenBank | EOU33338.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli KTE7] |
| GI:16130246 | GenBank | EOU36211.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli KTE3] |
| GI:16130246 | GenBank | EOU62783.1 | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli KTE19] |
| GI:16130246 | gnl | REF_goetting | 189 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli 536] |