Gene/Proteome Database (LMPD)
LMPD ID
LMP007764
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative acyl transferase
Gene Symbol
Synonyms
ECK2052; JW2043
Summary
WcaB contains hexapeptide repeats. [More information is available at EcoGene: EG13570]. WcaB is believed to be an acetyl transferase involved in colanic acid synthesis based on sequence similarity and its presence in a putative colanic acid synthesis operon . wcaB was shown to not be expressed when cultured in rich medium . wcaB was shown to be upregulated in response to osmotic shock and in sessile bacteria . [More information is available at EcoCyc: G7103].
Orthologs
Proteins
| putative acyl transferase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416562 |
| Protein GI | 16129998 |
| UniProt ID | P0ACC9 |
| Length | 162 |
| RefSeq Status | REVIEWED |
| MLEDLRANSWSLRPCCMVLAYRVAHFCSVWRKKNVLNNLWAAPLLVLYRIITECFFGYEIQAAATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPHIGNGVELGANVIILGDITLGNNVTVGAGSVVLDSVPDNALVVGEKARVKVIK | |
Gene Information
Entrez Gene ID
Gene Name
putative acyl transferase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:InterPro | C | cytoplasm |
| GO:0016407 | ISS:EcoliWiki | F | acetyltransferase activity |
| GO:0009001 | IEA:InterPro | F | serine O-acetyltransferase activity |
| GO:0006535 | IEA:InterPro | P | cysteine biosynthetic process from serine |
| GO:0009103 | IEA:UniProtKB-KW | P | lipopolysaccharide biosynthetic process |
| GO:0045228 | IEA:UniProtKB-UniPathway | P | slime layer polysaccharide biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Pathway | Slime biogenesis; slime polysaccharide biosynthesis. |
| Similarity | Belongs to the transferase hexapeptide repeat family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007764 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16129998 | RefSeq | NP_416562 | 162 | putative acyl transferase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007764 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129998 | GenBank | KHI93186.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | GenBank | KHJ03125.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | GenBank | KHJ10254.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | GenBank | KHJ28410.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | GenBank | KHJ29102.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | gnl | IGS | 162 | putative acyl transferase [Escherichia coli ER2796] |
Related Sequences to LMP007764 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129998 | GenBank | EHW94284.1 | 162 | bacterial transferase hexapeptide family protein [Escherichia coli DEC10F] |
| GI:16129998 | GenBank | EQW32600.1 | 162 | colanic acid biosynthesis acetyltransferase WcaB [Escherichia coli UMEA 3052-1] |
| GI:16129998 | GenBank | KEN24827.1 | 162 | colanic acid biosynthesis acetyltransferase WcaB [Escherichia coli 8-415-05_S1_C1] |
| GI:16129998 | GenBank | KEO09684.1 | 162 | colanic acid biosynthesis acetyltransferase WcaB [Escherichia coli 8-415-05_S1_C2] |
| GI:16129998 | RefSeq | WP_000888727.1 | 162 | acyl transferase [Escherichia coli] |
| GI:16129998 | RefSeq | WP_021553712.1 | 162 | colanic acid biosynthesis acetyltransferase WcaB [Escherichia coli] |