Gene/Proteome Database (LMPD)

LMPD ID
LMP007861
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein COQ-5
Gene Symbol
Synonyms
CELE_ZK652.9
Alternate Names
Protein COQ-5
Chromosome
III
EC Number
2.1.1.201

Proteins

Protein COQ-5
Refseq ID NP_498704
Protein GI 17557039
UniProt ID P34666
mRNA ID NM_066303
Length 285
RefSeq Status REVIEWED
MKGATNLFKSMRKPTNVGNFRQFSVNQVNSDNKRSEPGKKTHFGFTDVDEAEKEQKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQVPYNAKCLDMAGGTGDIAFRILRHSPTAKVTVSDINQPMLDVGKKRAEKERDIQPSRAEWVCANAEQMPFESNTYDLFTMSFGIRNCTHPEKVVREAFRVLKPGGQLAILEFSEVNSALKPIYDAYSFNVIPVLGEILASDRASYQYLVESIRKFPNQDEFARIIREEGFSNVRYENLTFGVCSIHKGMKPRK

Gene Information

Entrez Gene ID
Gene Name
Protein COQ-5
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0008168 IEA:UniProtKB-KW F methyltransferase activity
GO:0006744 IMP:WormBase P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00130 Ubiquinone and other terpenoid-quinone biosynthesis
cel_M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

REACTOME Pathway Links

REACTOME Pathway ID Description
5653474 Ubiquinol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR029063 S-adenosyl-L-methionine-dependent methyltransferase
IPR004033 UbiE/COQ5 methyltransferase
IPR023576 UbiE/COQ5 methyltransferase, conserved site

UniProt Annotations

Entry Information

Gene Name
Protein COQ-5
Protein Entry
COQ5_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity S-adenosyl-L-methionine + 2-methoxy-6-all- trans-polyprenyl-1,4-benzoquinol = S-adenosyl-L-homocysteine + 6- methoxy-3-methyl-2-all-trans-polyprenyl-1,4-benzoquinol.
Function Methyltransferase required for the conversion of 2- polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3- methyl-6-methoxy-1,4-benzoquinol (DMQH2). {ECO:0000269|PubMed:14695939}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the class I-like SAM-binding methyltransferase superfamily. UbiE family. {ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007861 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17557039 RefSeq NP_498704 285 Protein COQ-5

Identical Sequences to LMP007861 proteins

Reference Database Accession Length Protein Name
GI:17557039 EMBL CCD62554.1 285 Protein COQ-5 [Caenorhabditis elegans]
GI:17557039 SwissProt P34666.2 285 RecName: Full=2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; AltName: Full=Ubiquinone biosynthesis methyltransferase COQ5; Flags: Precursor [Caenorhabditis elegans]

Related Sequences to LMP007861 proteins

Reference Database Accession Length Protein Name
GI:17557039 EMBL CAP31260.2 270 Protein CBR-COQ-5 [Caenorhabditis briggsae]
GI:17557039 GenBank EFP04262.1 285 CRE-COQ-5 protein [Caenorhabditis remanei]
GI:17557039 GenBank EGT56690.1 252 hypothetical protein CAEBREN_25779 [Caenorhabditis brenneri]
GI:17557039 GenBank EYC37719.1 282 hypothetical protein Y032_0770g2216 [Ancylostoma ceylanicum]
GI:17557039 RefSeq XP_002642671.1 281 C. briggsae CBR-COQ-5 protein [Caenorhabditis briggsae]
GI:17557039 RefSeq XP_003103204.1 285 CRE-COQ-5 protein [Caenorhabditis remanei]