Gene/Proteome Database (LMPD)
Proteins
Niemann-Pick type C-2e | |
---|---|
Refseq ID | NP_731439 |
Protein GI | 221378617 |
UniProt ID | Q9VH33 |
mRNA ID | NM_169323 |
Length | 168 |
RefSeq Status | REVIEWED |
MLRIVVTLALILATVNATNVQQCKNKPFPLDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFPEITADVTVTLNDAQNEPITCFVVSCKIRKGATAAQMDGYLLDWTNPL |
Gene Information
Entrez Gene ID
Gene Name
Niemann-Pick type C-2e
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005615 | IDA:FlyBase | C | extracellular space |
GO:0030882 | IDA:FlyBase | F | lipid antigen binding |
GO:0001530 | IDA:FlyBase | F | lipopolysaccharide binding |
GO:0070891 | IDA:FlyBase | F | lipoteichoic acid binding |
GO:0042834 | IDA:FlyBase | F | peptidoglycan binding |
GO:0061057 | IMP:FlyBase | P | peptidoglycan recognition protein signaling pathway |
GO:0015918 | ISS:FlyBase | P | sterol transport |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP009057 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
221378617 | RefSeq | NP_731439 | 168 | Niemann-Pick type C-2e |
Identical Sequences to LMP009057 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221378617 | gnl | FlyBase | 168 | Niemann-Pick type C-2e [Drosophila melanogaster] |
Related Sequences to LMP009057 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221378617 | GenBank | EDV49675.1 | 168 | GG17324 [Drosophila erecta] |
GI:221378617 | GenBank | EDW42777.1 | 168 | GM23854 [Drosophila sechellia] |
GI:221378617 | GenBank | EDX13531.1 | 168 | GD18662 [Drosophila simulans] |
GI:221378617 | GenBank | ADL59625.1 | 190 | MIP24405p, partial [Drosophila melanogaster] |
GI:221378617 | RefSeq | XP_001980717.1 | 168 | GG17324 [Drosophila erecta] |
GI:221378617 | RefSeq | XP_002104028.1 | 168 | GD18662 [Drosophila simulans] |