Gene/Proteome Database (LMPD)
LMPD ID
LMP010012
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
cardiolipin synthase
Gene Symbol
Synonyms
cardiolipin synthase; CLS; T4B21.19; T4B21_19
Alternate Names
cardiolipin synthase
Chromosome
4
EC Number
2.7.8.-
Summary
Encodes a protein with cardiolipin synthase activity that is localized to the mitochondiria.
Orthologs
Proteins
| cardiolipin synthase | |
|---|---|
| Refseq ID | NP_567273 |
| Protein GI | 18412722 |
| UniProt ID | Q93YW7 |
| mRNA ID | NM_116725 |
| Length | 341 |
| RefSeq Status | REVIEWED |
| MAIYRSLRKLVEINHRKTRPFFTAATASGGTVSLTPPQFSPLFPHFSHRLSPLSKWFVPLNGPLFLSSPPWKLLQSATPLHWRGNGSVLKKVEALNLRLDRIRSRTRFPRQLGLQSVVPNILTVDRNDSKEEDGGKLVKSFVNVPNMISMARLVSGPVLWWMISNEMYSSAFLGLAVSGASDWLDGYVARRMKINSVVGSYLDPLADKVLIGCVAVAMVQKDLLHPGLVGIVLLRDVALVGGAVYLRALNLDWKWKTWSDFFNLDGSSPQKVEPLFISKVNTVFQLTLVAGAILQPEFGNPDTQTWITYLSWLVASTTMASTAAYGVQYWKKRPISMIKRS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
| GO:0005739 | IDA:TAIR | C | mitochondrion |
| GO:0008808 | IDA:TAIR | F | cardiolipin synthase activity |
| GO:0030145 | IDA:UniProtKB | F | manganese ion binding |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=150 uM for phosphatidylglycerol (dioleoyl species) {ECO:0000269|PubMed:15811335}; KM=4 uM for CDP-dioleoylglycerol {ECO:0000269|PubMed:15811335}; pH dependence: Optimum pH is about 9.0. {ECO:0000269|PubMed:15811335}; |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:15811335}; |
| Disruption Phenotype | Strong dwarf phenotype, small siliques with only a few small-sized and sterile seeds, when grown in long day conditions under low light. Dysfunction of mitochondria: abnormal ultrastructure, reduced content of respiratory complex I/complex III supercomplexes and marked accumulation of tricarboxylic acid cycle derivatives and amino acids. {ECO:0000269|PubMed:24151294, ECO:0000269|PubMed:24443516}. |
| Function | Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). Cannot catalyze the phosphatidyl group transfer from one PG molecule to another to form CL. Possesses high activity with PG species carrying dioleoyl groups and low activity with species carrying one or two palmitoyl groups. CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions. In mitochondrial fission, CL stabilizes the protein complex of the major mitochondrial fission factors, DRP3A and DRP3B. {ECO:0000269|PubMed:15527784, ECO:0000269|PubMed:15811335, ECO:0000269|PubMed:24151294, ECO:0000269|PubMed:24443516}. |
| Sequence Caution | Sequence=AAD03458.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB80852.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion inner membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010012 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18412722 | RefSeq | NP_567273 | 341 | cardiolipin synthase |
Identical Sequences to LMP010012 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18412722 | EMBL | CAY37211.1 | 341 | unnamed protein product [Arabidopsis thaliana] |
| GI:18412722 | GenBank | AAL24147.1 | 341 | putative phosphatidylglycerotransferase [Arabidopsis thaliana] |
| GI:18412722 | GenBank | AAM14208.1 | 341 | putative phosphatidylglycerotransferase [Arabidopsis thaliana] |
| GI:18412722 | GenBank | AEE82435.1 | 341 | cardiolipin synthase [Arabidopsis thaliana] |
| GI:18412722 | SwissProt | Q93YW7.1 | 341 | RecName: Full=Cardiolipin synthase, mitochondrial; Short=CLS; AltName: Full=Phosphatidylglycerophosphate synthase 3; Short=PGP synthase 3; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010012 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18412722 | GenBank | AAM64561.1 | 341 | putative phosphatidylglycerotransferase [Arabidopsis thaliana] |
| GI:18412722 | GenBank | EFH51075.1 | 340 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18412722 | GenBank | EOA21021.1 | 340 | hypothetical protein CARUB_v10001355mg [Capsella rubella] |
| GI:18412722 | RefSeq | XP_002874816.1 | 340 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18412722 | RefSeq | XP_006288123.1 | 340 | hypothetical protein CARUB_v10001355mg [Capsella rubella] |
| GI:18412722 | RefSeq | XP_010422322.1 | 340 | PREDICTED: cardiolipin synthase, mitochondrial [Camelina sativa] |