Gene/Proteome Database (LMPD)

LMPD ID
LMP010159
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Defender against cell death 2
Gene Symbol
Synonyms
DEFENDER AGAINST CELL DEATH 2; T32F12.10; T32F12_10
Chromosome
2

Proteins

Defender against cell death 2
Refseq ID NP_850247
Protein GI 30686440
UniProt ID F4IKR2
mRNA ID NM_179916
Length 116
RefSeq Status REVIEWED
MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQQVAYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG
Defender against cell death 2
Refseq ID NP_565807
Protein GI 18403864
UniProt ID Q1H575
mRNA ID NM_129104
Length 115
RefSeq Status REVIEWED
MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQVAYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG

Gene Information

Entrez Gene ID
Gene Name
Defender against cell death 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IEA:InterPro C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
Defender against cell death 2
Protein Entry
DAD2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit Component of the oligosaccharyltransferase (OST) complex.

Identical and Related Proteins

Unique RefSeq proteins for LMP010159 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30686440 RefSeq NP_850247 116 Defender against cell death 2
18403864 RefSeq NP_565807 115 Defender against cell death 2

Identical Sequences to LMP010159 proteins

Reference Database Accession Length Protein Name
GI:18403864 DBBJ BAC43589.1 115 putative defender against cell death protein [Arabidopsis thaliana]
GI:18403864 EMBL CAC80055.1 115 DAD1 protein [Arabidopsis thaliana]
GI:18403864 GenBank AAM65506.1 115 defender against cell death protein [Arabidopsis thaliana]
GI:18403864 GenBank ABF59007.1 115 At2g35520 [Arabidopsis thaliana]
GI:18403864 GenBank ABI00359.1 115 Sequence 13 from patent US 7071382
GI:18403864 GenBank AEC09116.1 115 Defender against cell death 2 [Arabidopsis thaliana]
GI:30686440 GenBank AEC09117.1 116 Defender against cell death 2 [Arabidopsis thaliana]

Related Sequences to LMP010159 proteins

Reference Database Accession Length Protein Name
GI:30686440 EMBL CAC80055.1 115 DAD1 protein [Arabidopsis thaliana]
GI:30686440 GenBank AAB86478.1 115 defender against cell death 2 [Arabidopsis thaliana]
GI:30686440 GenBank AAM65506.1 115 defender against cell death protein [Arabidopsis thaliana]
GI:18403864 GenBank AEC09117.1 116 Defender against cell death 2 [Arabidopsis thaliana]
GI:18403864 GenBank ESQ52163.1 115 hypothetical protein EUTSA_v10017441mg [Eutrema salsugineum]
GI:30686440 gnl TIGR 115 defender against cell death protein [Arabidopsis thaliana]
GI:30686440 RefSeq NP_565807.1 115 Defender against cell death 2 [Arabidopsis thaliana]
GI:18403864 RefSeq NP_850247.1 116 Defender against cell death 2 [Arabidopsis thaliana]
GI:18403864 RefSeq XP_006410710.1 115 hypothetical protein EUTSA_v10017441mg [Eutrema salsugineum]
GI:18403864 RefSeq XP_010509606.1 115 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 [Camelina sativa]
GI:18403864 RefSeq XP_010516729.1 115 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2-like [Camelina sativa]
GI:30686440 SwissProt O22622.1 115 RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2; Short=Oligosaccharyl transferase subunit DAD2; AltName: Full=Defender against cell death 2; Short=AtDAD2; Short=DAD-2 [Arabidopsis thaliana]