Gene/Proteome Database (LMPD)
Proteins
| palmitoyl protein thioesterase family protein | |
|---|---|
| Refseq ID | NP_199545 |
| Protein GI | 42568368 |
| UniProt ID | F4JX42 |
| mRNA ID | NM_124105 |
| Length | 317 |
| RefSeq Status | REVIEWED |
| MEKGLKRSCVMVVVAFLAKVDISVSVPFIMLHGIASQCSDDTNANFTQLLTNLSGSPGFCLEIGNGVINSMFLPLTQQAEIACENVKEMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVFNYISLAGPHAGISSLPRGLCGLTSDPACKKFNELIKGALYSETIQDHLAPSGYYKIPNDMKQYLERSKYLPKLNNEIPNQRNQTYKDRFTSLHNLVLVKFQDDEVITPNDSTWFGFYPDGEFETLLSANQTKLYTEDWIGLKTLDDAGKVKFVSVPGGHVRMAEEDVVKYVVPYLQNQQPAAQSFNRKTKEPLHP | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl protein thioesterase family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008474 | IEA:InterPro | F | palmitoyl-(protein) hydrolase activity |
| GO:0006464 | IEA:InterPro | P | cellular protein modification process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl protein thioesterase family protein
Protein Entry
F4JX42_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP010727 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 42568368 | RefSeq | NP_199545 | 317 | palmitoyl protein thioesterase family protein |
Identical Sequences to LMP010727 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42568368 | gnl | TAIR | 317 | palmitoyl protein thioesterase family protein [Arabidopsis thaliana] |
Related Sequences to LMP010727 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42568368 | DBBJ | BAA97168.1 | 293 | palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana] |
| GI:42568368 | GenBank | EFH41384.1 | 317 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:42568368 | GenBank | EFH41385.1 | 314 | hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. lyrata] |
| GI:42568368 | gnl | TAIR | 314 | palmitoyl protein thioesterase family protein [Arabidopsis thaliana] |
| GI:42568368 | RefSeq | XP_002865125.1 | 317 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:42568368 | RefSeq | XP_002865126.1 | 314 | hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. lyrata] |