Gene/Proteome Database (LMPD)

LMPD ID
LMP010903
Gene ID
816341
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphopantetheine adenylyltransferase
Gene Symbol
COAD
Synonyms
4-phosphopantetheine adenylyltransferase; ATCOAD; COAD; T30D6.24; T30D6_24
Alternate Names
phosphopantetheine adenylyltransferase
Chromosome
2
EC Number
2.7.7.3
Summary
At2g18250 encodes pantetheine-phosphate adenylyltransferase catalyzing the formation of dephospho-CoA from pantetheine 4'-phosphate. The enzyme is involved in coenzyme A biosynthesis.
Orthologs
View orthologs and multiple alignments for COAD

Proteins

phosphopantetheine adenylyltransferase
Refseq ID NP_179417
Protein GI 15224138
UniProt ID Q9ZPV8
mRNA ID NM_127383
Length 176
RefSeq Status REVIEWED
MAAPEDSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMIQPIEERMRNVETYVKSIKPELVVQAEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNRKRAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPAEEKAS

Gene Information

Entrez Gene ID
816341
Gene Name
phosphopantetheine adenylyltransferase
Gene Symbol
COAD
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:TAIR C cytosol
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004595 IDA:TAIR F pantetheine-phosphate adenylyltransferase activity
GO:0015937 IDA:TAIR P coenzyme A biosynthetic process
GO:0040007 IMP:TAIR P growth
GO:0006629 IMP:TAIR P lipid metabolic process
GO:0019915 IMP:TAIR P lipid storage
GO:0080020 IMP:TAIR P regulation of coenzyme A biosynthetic process
GO:0006970 IMP:TAIR P response to osmotic stress
GO:0009651 IMP:TAIR P response to salt stress

KEGG Pathway Links

KEGG Pathway ID Description
ath_M00120 Coenzyme A biosynthesis, pantothenate => CoA
ath01100 Metabolic pathways
ath00770 Pantothenate and CoA biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254055 Coenzyme A biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR004821 Cytidyltransferase-like domain
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold

UniProt Annotations

Entry Information

Gene Name
phosphopantetheine adenylyltransferase
Protein Entry
COAD_ARATH
UniProt ID
Q9ZPV8
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=37 uM for 3'-dephospho-CoA {ECO:0000269|PubMed:18621975}; Vmax=0.34 umol/min/mg enzyme for the reverse reaction {ECO:0000269|PubMed:18621975};
Catalytic Activity ATP + pantetheine 4'-phosphate = diphosphate + 3'-dephospho-CoA.
Disruption Phenotype Plants are severely impaired in plant growth and seed production, but almost not affected in the accumulation of total fatty acids per seed. {ECO:0000269|PubMed:18621975}.
Enzyme Regulation Inhibited by CoA. {ECO:0000269|PubMed:18621975}.
Function Reversibly transfers an adenylyl group from ATP to 4'- phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Does not accept 4'-phosphopantothenoylcysteine as a substrate. {ECO:0000269|PubMed:12860978, ECO:0000269|PubMed:18621975}.
Pathway Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 4/5.
Similarity Belongs to the eukaryotic CoaD family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010903 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15224138 RefSeq NP_179417 176 phosphopantetheine adenylyltransferase

Identical Sequences to LMP010903 proteins

Reference Database Accession Length Protein Name
GI:15224138 DBBJ BAD44660.1 176 hypothetical protein [Arabidopsis thaliana]
GI:15224138 GenBank AAQ65117.1 176 At2g18250 [Arabidopsis thaliana]
GI:15224138 GenBank AEC06746.1 176 phosphopantetheine adenylyltransferase [Arabidopsis thaliana]
GI:15224138 gnl TIGR 176 hypothetical protein [Arabidopsis thaliana]
GI:15224138 SwissProt Q9ZPV8.1 176 RecName: Full=Phosphopantetheine adenylyltransferase; AltName: Full=AtCoaD; AltName: Full=Dephospho-CoA pyrophosphorylase; AltName: Full=Pantetheine-phosphate adenylyltransferase [Arabidopsis thaliana]

Related Sequences to LMP010903 proteins

Reference Database Accession Length Protein Name
GI:15224138 GenBank EFH60382.1 176 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:15224138 GenBank EOA31569.1 176 hypothetical protein CARUB_v10014762mg [Capsella rubella]
GI:15224138 RefSeq XP_002884123.1 176 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:15224138 RefSeq XP_006298671.1 176 hypothetical protein CARUB_v10014762mg [Capsella rubella]
GI:15224138 RefSeq XP_010425201.1 510 PREDICTED: syntaxin-112-like [Camelina sativa]
GI:15224138 RefSeq XP_010490434.1 512 PREDICTED: syntaxin-112-like [Camelina sativa]