Gene/Proteome Database (LMPD)

LMPD ID
LMP010995
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 1
Gene Symbol
Synonyms
MTE17.9; MTE17_9
Alternate Names
putative long-chain-alcohol O-fatty-acyltransferase 1
Chromosome
5
EC Number
2.3.1.75

Proteins

putative long-chain-alcohol O-fatty-acyltransferase 1
Refseq ID NP_200349
Protein GI 15240500
UniProt ID Q9FJ72
mRNA ID NM_124920
Length 341
RefSeq Status REVIEWED
MEEKFRNLIEVWISALISLSYCYYISSKLSKGVLRLLSILPVCILFLVLPLFLSCVHFCAISVLFLSWLANFKLLLFAFDEGPLFPLPPKLSRFICFACLPIKIRQDPSPNAIPNLHPKPMPKWVLAVKILVLGVLLHVYEYRDGLPRFVVLALYCLHIYLEVELVLVFVGAVVSTLLGCNIEPVFNEPYLATSLQDFWSRRWNLMVSAVLRSTVHIPVQRFFKRILSPDGAMFAGVMASFFVSGLMHELLYFYMIRKPPTWEVTCFFVLHGAATATEIAVKRTQWLRPPHRAVSGLVVLTFVSVTGVWLFLAQVLRNNVHEKAIGECLLVLDLAKLFTSS

Gene Information

Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047196 IEA:UniProtKB-EC F long-chain-alcohol O-fatty-acyltransferase activity
GO:0006629 IEA:UniProtKB-KW P lipid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-282 cuticular wax biosynthesis
PWY-5884 wax esters biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR017088 Wax synthase

UniProt Annotations

Entry Information

Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 1
Protein Entry
WAXS1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.
Function Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}.
Similarity Belongs to the wax synthase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010995 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240500 RefSeq NP_200349 341 putative long-chain-alcohol O-fatty-acyltransferase 1

Identical Sequences to LMP010995 proteins

Reference Database Accession Length Protein Name
GI:15240500 GenBank AAL91291.1 341 At5g55380 [Arabidopsis thaliana]
GI:15240500 GenBank AAN28807.1 341 At5g55380/MTE17_9 [Arabidopsis thaliana]
GI:15240500 GenBank ACC06868.1 341 Sequence 4 from patent US 7332311
GI:15240500 GenBank ACW86222.1 341 Sequence 2472 from patent US 7569389
GI:15240500 gnl TAIR 341 putative long-chain-alcohol O-fatty-acyltransferase [Arabidopsis thaliana]
GI:15240500 SwissProt Q9FJ72.1 341 RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 1; AltName: Full=Wax synthase 1 [Arabidopsis thaliana]

Related Sequences to LMP010995 proteins

Reference Database Accession Length Protein Name
GI:15240500 GenBank EFH42352.1 346 hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. lyrata]
GI:15240500 GenBank EOA13640.1 345 hypothetical protein CARUB_v10026711mg [Capsella rubella]
GI:15240500 RefSeq XP_002866093.1 346 hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. lyrata]
GI:15240500 RefSeq XP_006280742.1 345 hypothetical protein CARUB_v10026711mg [Capsella rubella]
GI:15240500 RefSeq XP_010443164.1 345 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 1 [Camelina sativa]
GI:15240500 RefSeq XP_010443165.1 345 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 1 [Camelina sativa]