Gene/Proteome Database (LMPD)
Proteins
putative long-chain-alcohol O-fatty-acyltransferase 1 | |
---|---|
Refseq ID | NP_200349 |
Protein GI | 15240500 |
UniProt ID | Q9FJ72 |
mRNA ID | NM_124920 |
Length | 341 |
RefSeq Status | REVIEWED |
MEEKFRNLIEVWISALISLSYCYYISSKLSKGVLRLLSILPVCILFLVLPLFLSCVHFCAISVLFLSWLANFKLLLFAFDEGPLFPLPPKLSRFICFACLPIKIRQDPSPNAIPNLHPKPMPKWVLAVKILVLGVLLHVYEYRDGLPRFVVLALYCLHIYLEVELVLVFVGAVVSTLLGCNIEPVFNEPYLATSLQDFWSRRWNLMVSAVLRSTVHIPVQRFFKRILSPDGAMFAGVMASFFVSGLMHELLYFYMIRKPPTWEVTCFFVLHGAATATEIAVKRTQWLRPPHRAVSGLVVLTFVSVTGVWLFLAQVLRNNVHEKAIGECLLVLDLAKLFTSS |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 1
Protein Entry
WAXS1_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010995 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15240500 | RefSeq | NP_200349 | 341 | putative long-chain-alcohol O-fatty-acyltransferase 1 |
Identical Sequences to LMP010995 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240500 | GenBank | AAL91291.1 | 341 | At5g55380 [Arabidopsis thaliana] |
GI:15240500 | GenBank | AAN28807.1 | 341 | At5g55380/MTE17_9 [Arabidopsis thaliana] |
GI:15240500 | GenBank | ACC06868.1 | 341 | Sequence 4 from patent US 7332311 |
GI:15240500 | GenBank | ACW86222.1 | 341 | Sequence 2472 from patent US 7569389 |
GI:15240500 | gnl | TAIR | 341 | putative long-chain-alcohol O-fatty-acyltransferase [Arabidopsis thaliana] |
GI:15240500 | SwissProt | Q9FJ72.1 | 341 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 1; AltName: Full=Wax synthase 1 [Arabidopsis thaliana] |
Related Sequences to LMP010995 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240500 | GenBank | EFH42352.1 | 346 | hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. lyrata] |
GI:15240500 | GenBank | EOA13640.1 | 345 | hypothetical protein CARUB_v10026711mg [Capsella rubella] |
GI:15240500 | RefSeq | XP_002866093.1 | 346 | hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. lyrata] |
GI:15240500 | RefSeq | XP_006280742.1 | 345 | hypothetical protein CARUB_v10026711mg [Capsella rubella] |
GI:15240500 | RefSeq | XP_010443164.1 | 345 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 1 [Camelina sativa] |
GI:15240500 | RefSeq | XP_010443165.1 | 345 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 1 [Camelina sativa] |