Gene/Proteome Database (LMPD)
Proteins
membrane-associated kinase regulator | |
---|---|
Refseq ID | NP_197995 |
Protein GI | 15239627 |
UniProt ID | Q3E936 |
mRNA ID | NM_122524 |
Length | 341 |
RefSeq Status | REVIEWED |
MRRQPPRPRNSPPQSHSSPSSSSSEFEFNISISPRKASSSLCPADELFYKGQLLPLQLSPRLSLVRTLGSSTSSSDYTSSSSSSVATSAARDSTESNSSTDSTASFPLLHPPPLDCCDSSRPSSVTDDEDFFFKPPKNKSSSGGFSLSRFSSVFKKDPKTNLHHHSSSSSTATTAAAPSSVKRMSSTAKEVIRKYMKKVKPLYEKLSPKQSSNIKTESSSSLKDSGNNIRGTTTVTTVTAAPTVVSSGGGLSISFSGNLMKYTKRGRCAASCPSSMRSSPNHSGVLTRGGFPVHQGSCSSSSSNNNSVSSSMEELQSAIQGAIAHCKNSMLQKNLVSSLEI |
Gene Information
Entrez Gene ID
Gene Name
membrane-associated kinase regulator
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0019210 | IMP:TAIR | F | kinase inhibitor activity |
GO:0009742 | IEA:UniProtKB-KW | P | brassinosteroid mediated signaling pathway |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
GO:0042326 | IMP:GOC | P | negative regulation of phosphorylation |
GO:0009741 | IMP:TAIR | P | response to brassinosteroid |
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
membrane-associated kinase regulator
Protein Entry
MAKR1_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | May negatively regulate brassinosteroid signaling. |
Subcellular Location | Cell membrane {ECO:0000250}. |
Subunit | A C-terminus-derived peptide binds BRI1 in vitro. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011006 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15239627 | RefSeq | NP_197995 | 341 | membrane-associated kinase regulator |
Identical Sequences to LMP011006 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15239627 | gnl | TAIR | 341 | membrane-associated kinase regulator [Arabidopsis thaliana] |
GI:15239627 | SwissProt | Q3E936.1 | 341 | RecName: Full=Probable membrane-associated kinase regulator 1 [Arabidopsis thaliana] |
Related Sequences to LMP011006 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15239627 | GenBank | EFH50566.1 | 335 | hypothetical protein ARALYDRAFT_489466 [Arabidopsis lyrata subsp. lyrata] |
GI:15239627 | RefSeq | XP_002874307.1 | 335 | hypothetical protein ARALYDRAFT_489466 [Arabidopsis lyrata subsp. lyrata] |
GI:15239627 | RefSeq | XP_006288080.1 | 348 | hypothetical protein CARUB_v10001312mg [Capsella rubella] |
GI:15239627 | RefSeq | XP_010421496.1 | 344 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |
GI:15239627 | RefSeq | XP_010454976.1 | 344 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |
GI:15239627 | RefSeq | XP_010493888.1 | 343 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |