Gene/Proteome Database (LMPD)

LMPD ID
LMP011530
Gene ID
317738
Species
Danio rerio (Zebrafish)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
elovl6
Synonyms
lce; cb618; zgc:73089
Alternate Names
elongation of very long chain fatty acids protein 6; ELOVL FA elongase 6; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase elovl6; very-long-chain 3-oxoacyl-CoA synthase 6; ELOVL family member 6, elongation of long chain fatty acids
Chromosome
14
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 6
Refseq ID NP_955826
Protein GI 41152490
UniProt ID Q6PC64
mRNA ID NM_199532
Length 266
RefSeq Status PROVISIONAL
MSVLALQEYEFERQFNEDEAIRWMQENWKKSFLFSALYAACILGGRHVMKQREKFELRKPLVLWSLTLAAFSIFGAIRTGGYMVNILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFKISRKFAMFITLTQITQMVMGCVVNYLVYLWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYITKRKSNAAKKSQ

Gene Information

Entrez Gene ID
317738
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
elovl6
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0019367 ISS:UniProtKB P fatty acid elongation, saturated fatty acid
GO:0042759 ISS:UniProtKB P long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
dre01040 Biosynthesis of unsaturated fatty acids
dre_M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
dre00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
6176816 Activation of gene expression by SREBF (SREBP)

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 6
Protein Entry
ELOV6_DANRE
UniProt ID
Q6PC64
Species
Zebrafish

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Function Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. {ECO:0000250}.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011530 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41152490 RefSeq NP_955826 266 elongation of very long chain fatty acids protein 6

Identical Sequences to LMP011530 proteins

Reference Database Accession Length Protein Name
GI:41152490 GenBank AEF65931.1 266 Sequence 75 from patent US 7932438
GI:41152490 GenBank AEW32760.1 266 Sequence 75 from patent US 8071341
GI:41152490 GenBank AFK97168.1 266 Sequence 75 from patent US 8158392
GI:41152490 GenBank AFL61061.1 266 Sequence 75 from patent US 8106226
GI:41152490 GenBank AGB67216.1 266 Sequence 75 from patent US 8288572
GI:41152490 GenBank AHE22394.1 266 Sequence 75 from patent US 8575377

Related Sequences to LMP011530 proteins

Reference Database Accession Length Protein Name
GI:41152490 RefSeq XP_004553671.1 269 PREDICTED: elongation of very long chain fatty acids protein 6-like [Maylandia zebra]
GI:41152490 RefSeq XP_005726534.1 269 PREDICTED: elongation of very long chain fatty acids protein 6-like [Pundamilia nyererei]
GI:41152490 RefSeq XP_005919487.1 269 PREDICTED: elongation of very long chain fatty acids protein 6-like [Haplochromis burtoni]
GI:41152490 RefSeq XP_006798910.1 269 PREDICTED: elongation of very long chain fatty acids protein 6-like [Neolamprologus brichardi]
GI:41152490 RefSeq XP_007245575.1 267 PREDICTED: elongation of very long chain fatty acids protein 6 [Astyanax mexicanus]
GI:41152490 RefSeq XP_008277700.1 269 PREDICTED: elongation of very long chain fatty acids protein 6 [Stegastes partitus]