Gene/Proteome Database (LMPD)
LMPD ID
LMP011925
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Synonyms
wu:fb60h11; zgc:112487
Alternate Names
serine palmitoyltransferase small subunit A; ssSPTa; small subunit of serine palmitoyltransferase A
Chromosome
17
Proteins
| serine palmitoyltransferase small subunit A | |
|---|---|
| Refseq ID | NP_001087196 |
| Protein GI | 148226648 |
| UniProt ID | Q5BJC1 |
| mRNA ID | NM_001093727 |
| Length | 68 |
| RefSeq Status | PROVISIONAL |
| MAFGDAWKQLSWFYYQYLLVTALYMLEPWERTIFNSLLISVAAMAVYTGYVFMPQHIMAILHYFEVVQ | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017059 | ISS:UniProtKB | C | serine C-palmitoyltransferase complex |
| GO:0006665 | IEA:UniProtKB-UniPathway | P | sphingolipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit A
Protein Entry
SPTSA_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference (By similarity). {ECO:0000250}. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Similarity | Belongs to the SPTSS family. SPTSSA subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Interacts with sptlc1; the interaction is direct. Component of the serine palmitoyltransferase (SPT) complex (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011925 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 148226648 | RefSeq | NP_001087196 | 68 | serine palmitoyltransferase small subunit A |
Identical Sequences to LMP011925 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148226648 | GenBank | AAH91542.1 | 68 | Zgc:112487 protein [Danio rerio] |
| GI:148226648 | SwissProt | Q5BJC1.1 | 68 | RecName: Full=Serine palmitoyltransferase small subunit A; AltName: Full=Small subunit of serine palmitoyltransferase A; Short=ssSPTa [Danio rerio] |
Related Sequences to LMP011925 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148226648 | RefSeq | XP_005811597.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A-like [Xiphophorus maculatus] |
| GI:148226648 | RefSeq | XP_007240530.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A [Astyanax mexicanus] |
| GI:148226648 | RefSeq | XP_007566328.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A [Poecilia formosa] |
| GI:148226648 | RefSeq | XP_008283106.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A [Stegastes partitus] |
| GI:148226648 | RefSeq | XP_008313085.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A [Cynoglossus semilaevis] |
| GI:148226648 | RefSeq | XP_008396893.1 | 68 | PREDICTED: serine palmitoyltransferase small subunit A [Poecilia reticulata] |