Gene/Proteome Database (LMPD)
LMPD ID
LMP012073
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Synonyms
S5AR 3; fj40g12; srd5a2l; wu:fj40g12; si:ch211-278f21.3
Alternate Names
polyprenol reductase; SR type 3; steroid 5-alpha-reductase 3; probable polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3
Chromosome
20
EC Number
1.3.1.94
Proteins
| polyprenol reductase precursor | |
|---|---|
| Refseq ID | NP_001038404 |
| Protein GI | 113679794 |
| UniProt ID | Q5RIU9 |
| mRNA ID | NM_001044939 |
| Length | 309 |
| RefSeq Status | PROVISIONAL |
| MFHILSIVNIIWLLLALCFGAAFCLNKFSVKLPNRVEHVFQDFIRYGKTKENIKRASWQLVFDLSKRYFYHFYVVSVMWNGLLLLFSIRSVVMSEAFPDWIIDVLGSLTGRSRGAWNEIHLSTLLLQVLLWVHTLRRLLECLFVSVFSDGVINVVQYAFGLSYYIILGLTVLCTNDSLPQSESVSFFNQLTWYHVVGTLLFFWASFLQHQSLSLLAKMRTDSSGKVETLAHKMPCGGWFELVSCPHYLAELLIYAAMCVCCGCASLTWWMVVLYVLCNQALAAQLCHEYYRSKFKTYPHHRKAFIPFVL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | ISS:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
| GO:0016628 | ISS:UniProtKB | F | oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor |
| GO:0019348 | ISS:UniProtKB | P | dolichol metabolic process |
| GO:0006488 | ISS:UniProtKB | P | dolichol-linked oligosaccharide biosynthetic process |
| GO:0016095 | ISS:UniProtKB | P | polyprenol catabolic process |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| dre00140 | Steroid hormone biosynthesis |
| ko00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
| Catalytic Activity | Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH. |
| Function | Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity). {ECO:0000250}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012073 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 113679794 | RefSeq | NP_001038404 | 309 | polyprenol reductase precursor |
Identical Sequences to LMP012073 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:113679794 | SwissProt | Q5RIU9.1 | 309 | RecName: Full=Polyprenol reductase; AltName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 3; AltName: Full=Steroid 5-alpha-reductase 3; Short=S5AR 3; Short=SR type 3 [Danio rerio] |
Related Sequences to LMP012073 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:113679794 | EMBL | CDQ73970.1 | 319 | unnamed protein product [Oncorhynchus mykiss] |
| GI:113679794 | GenBank | AAI33965.1 | 309 | Steroid 5 alpha-reductase 3 [Danio rerio] |
| GI:113679794 | RefSeq | XP_004557203.1 | 314 | PREDICTED: polyprenol reductase-like [Maylandia zebra] |
| GI:113679794 | RefSeq | XP_005732348.1 | 314 | PREDICTED: polyprenol reductase-like [Pundamilia nyererei] |
| GI:113679794 | RefSeq | XP_005923367.1 | 319 | PREDICTED: polyprenol reductase-like isoform X1 [Haplochromis burtoni] |
| GI:113679794 | RefSeq | XP_007257110.1 | 312 | PREDICTED: polyprenol reductase [Astyanax mexicanus] |