Gene/Proteome Database (LMPD)

LMPD ID
LMP012483
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Synonyms
SKR6R;
Alternate Names
cannabinoid receptor 1; CB1; CB-R; brain-type cannabinoid receptor;
Chromosome
5
Map Location
5q21
Summary
G-protein coupled receptor for psychoactive cannabinoids; may mediate inhibition of NO production and participate in retrograde signaling by endocannabinoids [RGD, Feb 2006]
Orthologs

Proteins

cannabinoid receptor 1
Refseq ID NP_036916
Protein GI 6978673
UniProt ID P20272
mRNA ID NM_012784
Length 473
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
mat_peptide: 1..473 product: cannabinoid receptor 1 calculated_mol_wt: 52845 peptide sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Gene Information

Entrez Gene ID
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0004949 IMP:RGD F cannabinoid receptor activity
GO:0008144 IMP:RGD F drug binding
GO:0007186 IMP:RGD P G-protein coupled receptor signaling pathway
GO:0007188 ISS:UniProtKB P adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007568 IMP:RGD P aging
GO:0038171 IMP:GOC P cannabinoid signaling pathway
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0007611 IMP:RGD P learning or memory
GO:0060135 IEP:RGD P maternal process involved in female pregnancy
GO:0007613 IDA:RGD P memory
GO:0045759 IMP:RGD P negative regulation of action potential
GO:0045776 IMP:RGD P negative regulation of blood pressure
GO:0033602 IMP:RGD P negative regulation of dopamine secretion
GO:0031999 IMP:RGD P negative regulation of fatty acid beta-oxidation
GO:0043271 IDA:RGD P negative regulation of ion transport
GO:0033004 IDA:RGD P negative regulation of mast cell activation
GO:0051001 IMP:RGD P negative regulation of nitric-oxide synthase activity
GO:0002866 IMP:RGD P positive regulation of acute inflammatory response to antigenic stimulus
GO:0043065 IMP:RGD P positive regulation of apoptotic process
GO:0045777 IMP:RGD P positive regulation of blood pressure
GO:0031622 IMP:RGD P positive regulation of fever generation
GO:0010976 IDA:RGD P positive regulation of neuron projection development
GO:0060259 IMP:RGD P regulation of feeding behavior
GO:0050796 IMP:RGD P regulation of insulin secretion
GO:0019216 IMP:RGD P regulation of lipid metabolic process
GO:0060405 IMP:RGD P regulation of penile erection
GO:0032228 IMP:RGD P regulation of synaptic transmission, GABAergic
GO:0051966 IMP:RGD P regulation of synaptic transmission, glutamatergic
GO:0042220 IMP:RGD P response to cocaine
GO:0045471 IMP:RGD P response to ethanol
GO:0032496 IMP:RGD P response to lipopolysaccharide
GO:0043278 IMP:RGD P response to morphine
GO:0035094 IMP:RGD P response to nicotine
GO:0007584 IEP:RGD P response to nutrient
GO:0019233 IMP:RGD P sensory perception of pain
GO:0007283 IEP:RGD P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction
ko04015 Rap1 signaling pathway
rno04015 Rap1 signaling pathway
ko04723 Retrograde endocannabinoid signaling
rno04723 Retrograde endocannabinoid signaling

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR000810 Cannabinoid receptor type 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 1 (brain)
Protein Entry
CNR1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current.
Interaction P30543:Adora2a; NbExp=3; IntAct=EBI-2909800, EBI-2902822;
Ptm Palmitoylation at Cys-416 is important for recruitment at both plasma membrane and lipid rafts
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane; Multi-pass membrane protein.
Subunit Interacts (via C-terminus) with CNRIP1

Identical and Related Proteins

Unique RefSeq proteins for LMP012483 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978673 RefSeq NP_036916 473 cannabinoid receptor 1

Identical Sequences to LMP012483 proteins

Reference Database Accession Length Protein Name
GI:6978673 GenBank AAA99067.1 473 neuronal cannabinoid receptor [Rattus norvegicus]
GI:6978673 GenBank EDL98589.1 473 cannabinoid receptor 1 (brain) [Rattus norvegicus]
GI:6978673 PRF - 473 cannabinoid receptor [Rattus norvegicus]
GI:6978673 RefSeq XP_006238046.1 473 PREDICTED: cannabinoid receptor 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012483 proteins

Reference Database Accession Length Protein Name
GI:6978673 EMBL CAA39332.1 473 CB1 cannabinoid receptor [Rattus norvegicus]
GI:6978673 PRF - 473 cannabinoid receptor [Rattus norvegicus]
GI:6978673 SwissProt P20272.1 473 RecName: Full=Cannabinoid receptor 1; Short=CB-R; Short=CB1; AltName: Full=Brain-type cannabinoid receptor [Rattus norvegicus]