Gene/Proteome Database (LMPD)
LMPD ID
LMP012483
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Synonyms
SKR6R;
Alternate Names
cannabinoid receptor 1; CB1; CB-R; brain-type cannabinoid receptor;
Chromosome
5
Map Location
5q21
Summary
G-protein coupled receptor for psychoactive cannabinoids; may mediate inhibition of NO production and participate in retrograde signaling by endocannabinoids [RGD, Feb 2006]
Orthologs
Proteins
cannabinoid receptor 1 | |
---|---|
Refseq ID | NP_036916 |
Protein GI | 6978673 |
UniProt ID | P20272 |
mRNA ID | NM_012784 |
Length | 473 |
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL | |
mat_peptide: 1..473 product: cannabinoid receptor 1 calculated_mol_wt: 52845 peptide sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Gene Information
Entrez Gene ID
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0004949 | IMP:RGD | F | cannabinoid receptor activity |
GO:0008144 | IMP:RGD | F | drug binding |
GO:0007186 | IMP:RGD | P | G-protein coupled receptor signaling pathway |
GO:0007188 | ISS:UniProtKB | P | adenylate cyclase-modulating G-protein coupled receptor signaling pathway |
GO:0007568 | IMP:RGD | P | aging |
GO:0038171 | IMP:GOC | P | cannabinoid signaling pathway |
GO:0042593 | IEA:Ensembl | P | glucose homeostasis |
GO:0007611 | IMP:RGD | P | learning or memory |
GO:0060135 | IEP:RGD | P | maternal process involved in female pregnancy |
GO:0007613 | IDA:RGD | P | memory |
GO:0045759 | IMP:RGD | P | negative regulation of action potential |
GO:0045776 | IMP:RGD | P | negative regulation of blood pressure |
GO:0033602 | IMP:RGD | P | negative regulation of dopamine secretion |
GO:0031999 | IMP:RGD | P | negative regulation of fatty acid beta-oxidation |
GO:0043271 | IDA:RGD | P | negative regulation of ion transport |
GO:0033004 | IDA:RGD | P | negative regulation of mast cell activation |
GO:0051001 | IMP:RGD | P | negative regulation of nitric-oxide synthase activity |
GO:0002866 | IMP:RGD | P | positive regulation of acute inflammatory response to antigenic stimulus |
GO:0043065 | IMP:RGD | P | positive regulation of apoptotic process |
GO:0045777 | IMP:RGD | P | positive regulation of blood pressure |
GO:0031622 | IMP:RGD | P | positive regulation of fever generation |
GO:0010976 | IDA:RGD | P | positive regulation of neuron projection development |
GO:0060259 | IMP:RGD | P | regulation of feeding behavior |
GO:0050796 | IMP:RGD | P | regulation of insulin secretion |
GO:0019216 | IMP:RGD | P | regulation of lipid metabolic process |
GO:0060405 | IMP:RGD | P | regulation of penile erection |
GO:0032228 | IMP:RGD | P | regulation of synaptic transmission, GABAergic |
GO:0051966 | IMP:RGD | P | regulation of synaptic transmission, glutamatergic |
GO:0042220 | IMP:RGD | P | response to cocaine |
GO:0045471 | IMP:RGD | P | response to ethanol |
GO:0032496 | IMP:RGD | P | response to lipopolysaccharide |
GO:0043278 | IMP:RGD | P | response to morphine |
GO:0035094 | IMP:RGD | P | response to nicotine |
GO:0007584 | IEP:RGD | P | response to nutrient |
GO:0019233 | IMP:RGD | P | sensory perception of pain |
GO:0007283 | IEP:RGD | P | spermatogenesis |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04080 | Neuroactive ligand-receptor interaction |
rno04080 | Neuroactive ligand-receptor interaction |
ko04015 | Rap1 signaling pathway |
rno04015 | Rap1 signaling pathway |
ko04723 | Retrograde endocannabinoid signaling |
rno04723 | Retrograde endocannabinoid signaling |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. |
Interaction | P30543:Adora2a; NbExp=3; IntAct=EBI-2909800, EBI-2902822; |
Ptm | Palmitoylation at Cys-416 is important for recruitment at both plasma membrane and lipid rafts |
Similarity | Belongs to the G-protein coupled receptor 1 family |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Subunit | Interacts (via C-terminus) with CNRIP1 |
Identical and Related Proteins
Unique RefSeq proteins for LMP012483 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6978673 | RefSeq | NP_036916 | 473 | cannabinoid receptor 1 |
Identical Sequences to LMP012483 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6978673 | GenBank | AAA99067.1 | 473 | neuronal cannabinoid receptor [Rattus norvegicus] |
GI:6978673 | GenBank | EDL98589.1 | 473 | cannabinoid receptor 1 (brain) [Rattus norvegicus] |
GI:6978673 | PRF | - | 473 | cannabinoid receptor [Rattus norvegicus] |
GI:6978673 | RefSeq | XP_006238046.1 | 473 | PREDICTED: cannabinoid receptor 1 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012483 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6978673 | EMBL | CAA39332.1 | 473 | CB1 cannabinoid receptor [Rattus norvegicus] |
GI:6978673 | PRF | - | 473 | cannabinoid receptor [Rattus norvegicus] |
GI:6978673 | SwissProt | P20272.1 | 473 | RecName: Full=Cannabinoid receptor 1; Short=CB-R; Short=CB1; AltName: Full=Brain-type cannabinoid receptor [Rattus norvegicus] |