Gene/Proteome Database (LMPD)

LMPD ID
LMP012748
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
Alternate Names
estradiol 17-beta-dehydrogenase 2; 17-beta-HSD 2; testosterone 17-beta-dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 2; 17-beta hydroxysteroid dehydrogenase type 2; 17-beta-hydroxysteroid dehydrogenase type 2;
Chromosome
19
Map Location
19q12
EC Number
1.1.1.62
Summary
17-beta hydroxysteroid enzyme that regulates the biological activity of sex hormones, including estrogen and androgens [RGD, Feb 2006]
Orthologs

Proteins

estradiol 17-beta-dehydrogenase 2
Refseq ID NP_077367
Protein GI 13242301
UniProt ID Q62730
mRNA ID NM_024391
Length 381
MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFLLSVSCFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGPGAEELRKNCSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGELIPMTVYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMVAAYASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEYVHTQKLALPVMREMSNPDITPVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLLDYILKNYFTPKLMPRALRTAS

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0004303 IDA:RGD F estradiol 17-beta-dehydrogenase activity
GO:0047035 IDA:RGD F testosterone dehydrogenase (NAD+) activity
GO:0006702 IDA:RGD P androgen biosynthetic process
GO:0060348 IEP:RGD P bone development
GO:0071248 IEP:RGD P cellular response to metal ion
GO:0006703 IDA:RGD P estrogen biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko04913 Ovarian steroidogenesis
rno04913 Ovarian steroidogenesis
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Protein Entry
DHB2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH.
Function Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Favors the oxidation of estradiol and testosterone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH (By similarity)
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Membrane ; Single-pass type II membrane protein .
Tissue Specificity Highest expression in placenta.

Identical and Related Proteins

Unique RefSeq proteins for LMP012748 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13242301 RefSeq NP_077367 381 estradiol 17-beta-dehydrogenase 2

Identical Sequences to LMP012748 proteins

Reference Database Accession Length Protein Name
GI:13242301 EMBL CAA62617.1 381 17-beta hydroxysteroid dehydrogenase type 2 [Rattus norvegicus]
GI:13242301 GenBank AEK13592.1 381 Sequence 4 from patent US 7972785
GI:13242301 SwissProt Q62730.1 381 RecName: Full=Estradiol 17-beta-dehydrogenase 2; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 2; Short=17-beta-HSD 2; AltName: Full=Testosterone 17-beta-dehydrogenase [Rattus norvegicus]

Related Sequences to LMP012748 proteins

Reference Database Accession Length Protein Name
GI:13242301 EMBL CAA62617.1 381 17-beta hydroxysteroid dehydrogenase type 2 [Rattus norvegicus]
GI:13242301 GenBank AEK13592.1 381 Sequence 4 from patent US 7972785
GI:13242301 SwissProt Q62730.1 381 RecName: Full=Estradiol 17-beta-dehydrogenase 2; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 2; Short=17-beta-HSD 2; AltName: Full=Testosterone 17-beta-dehydrogenase [Rattus norvegicus]