Gene/Proteome Database (LMPD)
LMPD ID
LMP012944
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Synonyms
Lce2; rELO2;
Alternate Names
elongation of very long chain fatty acids protein 6; ELOVL FA elongase 6; fatty acid elongase 2; fatty acyl-CoA elongase; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase Elovl6; very-long-chain 3-oxoacyl-CoA synthase 6; ELOVL family member 6, elongation of long chain fatty acids;
Chromosome
2
Map Location
2q42
EC Number
2.3.1.199
Summary
mouse homolog is a long chain fatty acyl elongase [RGD, Feb 2006]
Orthologs
Proteins
| elongation of very long chain fatty acids protein 6 | |
|---|---|
| Refseq ID | NP_599210 |
| Protein GI | 25742686 |
| UniProt ID | Q920L6 |
| mRNA ID | NM_134383 |
| Length | 267 |
| MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFEAYIGKVKKATKAE | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009922 | IDA:UniProtKB | F | fatty acid elongase activity |
| GO:0034625 | IDA:UniProtKB | P | fatty acid elongation, monounsaturated fatty acid |
| GO:0019367 | IDA:UniProtKB | P | fatty acid elongation, saturated fatty acid |
| GO:0042759 | ISS:UniProtKB | P | long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01040 | Biosynthesis of unsaturated fatty acids |
| rno01040 | Biosynthesis of unsaturated fatty acids |
| M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| ko00062 | Fatty acid elongation |
| rno00062 | Fatty acid elongation |
| ko01212 | Fatty acid metabolism |
| rno01212 | Fatty acid metabolism |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954496 | Activation of gene expression by SREBF (SREBP) |
| 5953463 | Fatty Acyl-CoA Biosynthesis |
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5954497 | Regulation of cholesterol biosynthesis by SREBP (SREBF) |
| 5953471 | Synthesis of very long-chain fatty acyl-CoAs |
| 5953464 | Triglyceride Biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Function | Condensing enzyme that catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree |
| Similarity | Belongs to the ELO family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
| Tissue Specificity | Expressed in liver and barely in brain |
Identical and Related Proteins
Unique RefSeq proteins for LMP012944 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 25742686 | RefSeq | NP_599210 | 267 | elongation of very long chain fatty acids protein 6 |
Identical Sequences to LMP012944 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:25742686 | GenBank | ACW64310.1 | 267 | Sequence 51 from patent US 7588931 |
| GI:25742686 | GenBank | AEF64639.1 | 267 | Sequence 64 from patent US 7932077 |
| GI:25742686 | GenBank | AGU18482.1 | 267 | Sequence 64 from patent US 8518674 |
| GI:25742686 | RefSeq | XP_008759707.1 | 267 | PREDICTED: elongation of very long chain fatty acids protein 6 [Rattus norvegicus] |
Related Sequences to LMP012944 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:25742686 | GenBank | ACM94131.1 | 267 | Sequence 48 from patent US 7465564 |
| GI:25742686 | GenBank | ACR90619.1 | 267 | Sequence 37 from patent US 7524658 |
| GI:25742686 | GenBank | ACW03025.1 | 267 | Sequence 84 from patent US 7550286 |
| GI:25742686 | GenBank | ACW64310.1 | 267 | Sequence 51 from patent US 7588931 |