Gene/Proteome Database (LMPD)

LMPD ID
LMP013045
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
3-oxoacyl-ACP synthase, mitochondrial
Gene Symbol
Synonyms
RGD1311092;
Alternate Names
3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial;
Chromosome
15
Map Location
15p16
EC Number
2.3.1.41

Proteins

3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
Refseq ID NP_001093978
Protein GI 213972556
UniProt ID G3V6R7
mRNA ID NM_001100508
Length 456
MLSKCLQHFLKAHLYPASYCWLISKHKFSGSVPAAGSRRRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKSIPCSVAAFVPRGSDKGQFNEQNFVSKSDAKSMSSPTIMAVGAAELALKDSGWYPKLEADQVATGVAIGMGMVPLEVVSETALMFQTKGYSKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRLIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPDQISYVNAHATSTPLGDAAENRAIKRLFRDHARALAISSTKGATGHLLGAAGAVEAAFTALACYHHKLPPTLNLDCTEAEFDLNYVPLEAQEWKTEGRCIGLTNSFGFGGTNATLCIAGM

Gene Information

Entrez Gene ID
Gene Name
3-oxoacyl-ACP synthase, mitochondrial
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-SubCell C mitochondrion
GO:0004315 IEA:UniProtKB-EC F 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0006637 IEA:Ensembl P acyl-CoA metabolic process
GO:0051792 IEA:Ensembl P medium-chain fatty acid biosynthetic process
GO:0051790 IEA:Ensembl P short-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00780 Biotin metabolism
rno00780 Biotin metabolism
ko00061 Fatty acid biosynthesis
rno00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR017568 3-oxoacyl-[acyl-carrier-protein] synthase 2
IPR014031 Beta-ketoacyl synthase, C-terminal
IPR014030 Beta-ketoacyl synthase, N-terminal
IPR018201 Beta-ketoacyl synthase, active site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
3-oxoacyl-ACP synthase, mitochondrial
Protein Entry
G3V6R7_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acyl-[acyl-carrier-protein] + malonyl-[acyl- carrier-protein] = 3-oxoacyl-[acyl-carrier-protein] + CO(2) + [acyl-carrier-protein]
Function May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function
Pathway Lipid metabolism; fatty acid biosynthesis
Similarity Belongs to the beta-ketoacyl-ACP synthases family
Subcellular Location Mitochondrion .

Identical and Related Proteins

Unique RefSeq proteins for LMP013045 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
213972556 RefSeq NP_001093978 456 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial

Identical Sequences to LMP013045 proteins

Reference Database Accession Length Protein Name
GI:213972556 GenBank EDL94095.1 456 rCG42150 [Rattus norvegicus]
GI:213972556 RefSeq XP_006251773.1 456 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X1 [Rattus norvegicus]

Related Sequences to LMP013045 proteins

Reference Database Accession Length Protein Name
GI:213972556 GenBank EDL94095.1 456 rCG42150 [Rattus norvegicus]
GI:213972556 RefSeq XP_006251773.1 456 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X1 [Rattus norvegicus]
GI:213972556 RefSeq XP_006518164.1 459 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X2 [Mus musculus]
GI:213972556 RefSeq XP_006518165.1 459 PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X3 [Mus musculus]