Gene/Proteome Database (LMPD)

LMPD ID
LMP013089
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
formyl peptide receptor 1
Gene Symbol
Alternate Names
fMet-Leu-Phe receptor;
Chromosome
1
Map Location
1q12

Proteins

fMet-Leu-Phe receptor
Refseq ID NP_001099686
Protein GI 157819173
UniProt ID D4A7Q2
mRNA ID NM_001106216
Length 355
MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRTVTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDINLFGSVFLIALIALDRCVCVLHPVWAQNHRTVTLAKKVIIVPWICAFLLTLPVIIRVTTVPNRLGPGKTACALDFSPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSIVAICYGLIATKIHRQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQIREHLRNIPQSTLTAMKITSSLAFFNSCLNPILYVFMGQDFRQRLIHSLPASLERALSEDSAQTSDTGTNLGANSIPENPANAM

Gene Information

Entrez Gene ID
Gene Name
formyl peptide receptor 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004982 IEA:InterPro F N-formyl peptide receptor activity
GO:0050786 IPI:RGD F RAGE receptor binding
GO:0007200 IEA:Ensembl P phospholipase C-activating G-protein coupled receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction
ko04015 Rap1 signaling pathway
rno04015 Rap1 signaling pathway
ko05150 Staphylococcus aureus infection
rno05150 Staphylococcus aureus infection

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954200 Formyl peptide receptors bind formyl peptides and many other ligands
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5954121 Peptide ligand-binding receptors
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR027345 Formyl peptide receptor 1
IPR000826 Formyl peptide receptor-related
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
formyl peptide receptor 1
Protein Entry
D4A7Q2_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013089 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157819173 RefSeq NP_001099686 355 fMet-Leu-Phe receptor

Identical Sequences to LMP013089 proteins

Reference Database Accession Length Protein Name
GI:157819173 GenBank EDL99792.1 355 formyl peptide receptor 1 (predicted) [Rattus norvegicus]
GI:157819173 RefSeq XP_006228050.1 355 PREDICTED: fMet-Leu-Phe receptor isoform X1 [Rattus norvegicus]

Related Sequences to LMP013089 proteins

Reference Database Accession Length Protein Name
GI:157819173 GenBank EDL99792.1 355 formyl peptide receptor 1 (predicted) [Rattus norvegicus]
GI:157819173 GenBank ABS90809.1 364 Sequence 10 from patent US 7198912
GI:157819173 RefSeq NP_038549.1 364 fMet-Leu-Phe receptor [Mus musculus]
GI:157819173 RefSeq XP_006228050.1 355 PREDICTED: fMet-Leu-Phe receptor isoform X1 [Rattus norvegicus]