Gene/Proteome Database (LMPD)
Proteins
fMet-Leu-Phe receptor | |
---|---|
Refseq ID | NP_001099686 |
Protein GI | 157819173 |
UniProt ID | D4A7Q2 |
mRNA ID | NM_001106216 |
Length | 355 |
MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRTVTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDINLFGSVFLIALIALDRCVCVLHPVWAQNHRTVTLAKKVIIVPWICAFLLTLPVIIRVTTVPNRLGPGKTACALDFSPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSIVAICYGLIATKIHRQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQIREHLRNIPQSTLTAMKITSSLAFFNSCLNPILYVFMGQDFRQRLIHSLPASLERALSEDSAQTSDTGTNLGANSIPENPANAM |
Gene Information
Entrez Gene ID
Gene Name
formyl peptide receptor 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0004982 | IEA:InterPro | F | N-formyl peptide receptor activity |
GO:0050786 | IPI:RGD | F | RAGE receptor binding |
GO:0007200 | IEA:Ensembl | P | phospholipase C-activating G-protein coupled receptor signaling pathway |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04080 | Neuroactive ligand-receptor interaction |
rno04080 | Neuroactive ligand-receptor interaction |
ko04015 | Rap1 signaling pathway |
rno04015 | Rap1 signaling pathway |
ko05150 | Staphylococcus aureus infection |
rno05150 | Staphylococcus aureus infection |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5954122 | Class A/1 (Rhodopsin-like receptors) |
5954200 | Formyl peptide receptors bind formyl peptides and many other ligands |
5954152 | G alpha (i) signalling events |
5953642 | GPCR downstream signaling |
5953758 | GPCR ligand binding |
5954121 | Peptide ligand-binding receptors |
5953381 | Signal Transduction |
5953391 | Signaling by GPCR |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013089 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157819173 | RefSeq | NP_001099686 | 355 | fMet-Leu-Phe receptor |
Identical Sequences to LMP013089 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157819173 | GenBank | EDL99792.1 | 355 | formyl peptide receptor 1 (predicted) [Rattus norvegicus] |
GI:157819173 | RefSeq | XP_006228050.1 | 355 | PREDICTED: fMet-Leu-Phe receptor isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013089 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157819173 | GenBank | EDL99792.1 | 355 | formyl peptide receptor 1 (predicted) [Rattus norvegicus] |
GI:157819173 | GenBank | ABS90809.1 | 364 | Sequence 10 from patent US 7198912 |
GI:157819173 | RefSeq | NP_038549.1 | 364 | fMet-Leu-Phe receptor [Mus musculus] |
GI:157819173 | RefSeq | XP_006228050.1 | 355 | PREDICTED: fMet-Leu-Phe receptor isoform X1 [Rattus norvegicus] |