Gene/Proteome Database (LMPD)

LMPD ID
LMP013340
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Gene Symbol
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta);
Chromosome
3
Map Location
3p13

Proteins

1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor
Refseq ID NP_001101291
Protein GI 157822109
UniProt ID D4AC45
mRNA ID NM_001107821
Length 278
MDPWPWLTAALLLLLLLVQLNRTARFYVKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQAKTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIRVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISEIPQENSTIKESGVLPAQ
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2691 peptide sequence: MDPWPWLTAALLLLLLLVQLNRT

Gene Information

Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016020 IEA:InterPro C membrane
GO:0003841 IEA:Ensembl F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0008544 IEP:RGD P epidermis development
GO:0006654 IEA:Ensembl P phosphatidic acid biosynthetic process
GO:0001819 IEA:Ensembl P positive regulation of cytokine production

KEGG Pathway Links

KEGG Pathway ID Description
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko00561 Glycerolipid metabolism
rno00561 Glycerolipid metabolism
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
rno01100 Metabolic pathways
M00089 Triacylglycerol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism
5953472 Synthesis of PA
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR004552 1-acyl-sn-glycerol-3-phosphate acyltransferase
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Protein Entry
D4AC45_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013340 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157822109 RefSeq NP_001101291 278 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor

Identical Sequences to LMP013340 proteins

Reference Database Accession Length Protein Name
GI:157822109 GenBank EDL93482.1 278 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus]

Related Sequences to LMP013340 proteins

Reference Database Accession Length Protein Name
GI:157822109 GenBank AAI25531.1 278 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus]
GI:157822109 GenBank EDL08324.1 278 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), isoform CRA_a [Mus musculus]
GI:157822109 GenBank EDL93482.1 278 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus]
GI:157822109 RefSeq NP_080488.1 278 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor [Mus musculus]