Gene/Proteome Database (LMPD)
LMPD ID
LMP013340
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Gene Symbol
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta);
Chromosome
3
Map Location
3p13
Proteins
1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor | |
---|---|
Refseq ID | NP_001101291 |
Protein GI | 157822109 |
UniProt ID | D4AC45 |
mRNA ID | NM_001107821 |
Length | 278 |
MDPWPWLTAALLLLLLLVQLNRTARFYVKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQAKTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIRVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISEIPQENSTIKESGVLPAQ | |
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2691 peptide sequence: MDPWPWLTAALLLLLLLVQLNRT |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016020 | IEA:InterPro | C | membrane |
GO:0003841 | IEA:Ensembl | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
GO:0008544 | IEP:RGD | P | epidermis development |
GO:0006654 | IEA:Ensembl | P | phosphatidic acid biosynthetic process |
GO:0001819 | IEA:Ensembl | P | positive regulation of cytokine production |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04975 | Fat digestion and absorption |
rno04975 | Fat digestion and absorption |
ko00561 | Glycerolipid metabolism |
rno00561 | Glycerolipid metabolism |
ko00564 | Glycerophospholipid metabolism |
rno00564 | Glycerophospholipid metabolism |
rno01100 | Metabolic pathways |
M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2
Protein Entry
D4AC45_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013340 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157822109 | RefSeq | NP_001101291 | 278 | 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor |
Identical Sequences to LMP013340 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822109 | GenBank | EDL93482.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus] |
Related Sequences to LMP013340 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822109 | GenBank | AAI25531.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] |
GI:157822109 | GenBank | EDL08324.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), isoform CRA_a [Mus musculus] |
GI:157822109 | GenBank | EDL93482.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus] |
GI:157822109 | RefSeq | NP_080488.1 | 278 | 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor [Mus musculus] |