Gene/Proteome Database (LMPD)

LMPD ID
LMP013418
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipid scramblase 3
Gene Symbol
Synonyms
Pls3;
Alternate Names
phospholipid scramblase 3; PL scramblase 3; ca(2+)-dependent phospholipid scramblase 3;
Chromosome
10
Map Location
10q24

Proteins

phospholipid scramblase 3
Refseq ID NP_001012139
Protein GI 58865848
UniProt ID Q6QBQ4
mRNA ID NM_001012139
Length 296
MAGYLPPKGYAPSPPPPYPVPAGYPEAAALHPGPGQAPVPTQGPAPAPGFSLFPSPGPVVPGPPGPFVPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGTGQQLGQAAEESNCCARLCCGARRPLRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFIPKFSILDADRQPVLRVVGPCCTCGCGTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS

Gene Information

Entrez Gene ID
Gene Name
phospholipid scramblase 3
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0071222 IEA:Ensembl P cellular response to lipopolysaccharide
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0042593 IEA:Ensembl P glucose homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR005552 Scramblase

UniProt Annotations

Entry Information

Gene Name
phospholipid scramblase 3
Protein Entry
PLS3_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ;
Domain The Proline-rich domain is required for phospholipid scramblase activity
Function May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages (By similarity)
Similarity Belongs to the phospholipid scramblase family
Subcellular Location Mitochondrion membrane ; Single-pass type II membrane protein .
Subunit Interacts with PDCD6 in a calcium-dependent manner

Identical and Related Proteins

Unique RefSeq proteins for LMP013418 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865848 RefSeq NP_001012139 296 phospholipid scramblase 3

Identical Sequences to LMP013418 proteins

Reference Database Accession Length Protein Name
GI:58865848 GenBank AAS55061.1 296 phospholipid scramblase 3 [Rattus norvegicus]
GI:58865848 GenBank AAH98055.1 296 Phospholipid scramblase 3 [Rattus norvegicus]
GI:58865848 SwissProt Q6QBQ4.1 296 RecName: Full=Phospholipid scramblase 3; Short=PL scramblase 3; AltName: Full=Ca(2+)-dependent phospholipid scramblase 3 [Rattus norvegicus]

Related Sequences to LMP013418 proteins

Reference Database Accession Length Protein Name
GI:58865848 GenBank AAS55061.1 296 phospholipid scramblase 3 [Rattus norvegicus]
GI:58865848 GenBank AAH98055.1 296 Phospholipid scramblase 3 [Rattus norvegicus]
GI:58865848 RefSeq XP_008766061.1 383 PREDICTED: phospholipid scramblase 3 isoform X1 [Rattus norvegicus]
GI:58865848 SwissProt Q6QBQ4.1 296 RecName: Full=Phospholipid scramblase 3; Short=PL scramblase 3; AltName: Full=Ca(2+)-dependent phospholipid scramblase 3 [Rattus norvegicus]