Gene/Proteome Database (LMPD)
Proteins
phospholipid scramblase 3 | |
---|---|
Refseq ID | NP_001012139 |
Protein GI | 58865848 |
UniProt ID | Q6QBQ4 |
mRNA ID | NM_001012139 |
Length | 296 |
MAGYLPPKGYAPSPPPPYPVPAGYPEAAALHPGPGQAPVPTQGPAPAPGFSLFPSPGPVVPGPPGPFVPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGTGQQLGQAAEESNCCARLCCGARRPLRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFIPKFSILDADRQPVLRVVGPCCTCGCGTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS |
Gene Information
Entrez Gene ID
Gene Name
phospholipid scramblase 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0006915 | IEA:UniProtKB-KW | P | apoptotic process |
GO:0071222 | IEA:Ensembl | P | cellular response to lipopolysaccharide |
GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
GO:0042593 | IEA:Ensembl | P | glucose homeostasis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005552 | Scramblase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; |
Domain | The Proline-rich domain is required for phospholipid scramblase activity |
Function | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages (By similarity) |
Similarity | Belongs to the phospholipid scramblase family |
Subcellular Location | Mitochondrion membrane ; Single-pass type II membrane protein . |
Subunit | Interacts with PDCD6 in a calcium-dependent manner |
Identical and Related Proteins
Unique RefSeq proteins for LMP013418 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
58865848 | RefSeq | NP_001012139 | 296 | phospholipid scramblase 3 |
Identical Sequences to LMP013418 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58865848 | GenBank | AAS55061.1 | 296 | phospholipid scramblase 3 [Rattus norvegicus] |
GI:58865848 | GenBank | AAH98055.1 | 296 | Phospholipid scramblase 3 [Rattus norvegicus] |
GI:58865848 | SwissProt | Q6QBQ4.1 | 296 | RecName: Full=Phospholipid scramblase 3; Short=PL scramblase 3; AltName: Full=Ca(2+)-dependent phospholipid scramblase 3 [Rattus norvegicus] |
Related Sequences to LMP013418 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58865848 | GenBank | AAS55061.1 | 296 | phospholipid scramblase 3 [Rattus norvegicus] |
GI:58865848 | GenBank | AAH98055.1 | 296 | Phospholipid scramblase 3 [Rattus norvegicus] |
GI:58865848 | RefSeq | XP_008766061.1 | 383 | PREDICTED: phospholipid scramblase 3 isoform X1 [Rattus norvegicus] |
GI:58865848 | SwissProt | Q6QBQ4.1 | 296 | RecName: Full=Phospholipid scramblase 3; Short=PL scramblase 3; AltName: Full=Ca(2+)-dependent phospholipid scramblase 3 [Rattus norvegicus] |