Gene/Proteome Database (LMPD)
Proteins
protein preY, mitochondrial precursor | |
---|---|
Refseq ID | NP_001019541 |
Protein GI | 66730545 |
UniProt ID | Q5U1Z8 |
mRNA ID | NM_001024370 |
Length | 112 |
MLTTTCRRLSQALQRPHALSAVAQRCLRAPGARSYADQNEKAEQPRTFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAARTTRQKEKQEETKQH | |
transit_peptide: 1..34 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q5U1Z8.1) calculated_mol_wt: 3721 peptide sequence: MLTTTCRRLSQALQRPHALSAVAQRCLRAPGARS mat_peptide: 35..112 product: Protein preY, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5U1Z8.1) calculated_mol_wt: 8949 peptide sequence: YADQNEKAEQPRTFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAARTTRQKEKQEETKQH |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | ISS:HGNC | C | endoplasmic reticulum membrane |
GO:0000506 | ISS:HGNC | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0006506 | ISS:HGNC | P | GPI anchor biosynthetic process |
GO:0009893 | ISS:HGNC | P | positive regulation of metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005651 | Uncharacterised protein family UPF0434/Trm112 |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Protein Entry
PREY_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Similarity | Belongs to the PREY family |
Similarity | Contains 1 TRM112 domain |
Subcellular Location | Mitochondrion . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013609 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
66730545 | RefSeq | NP_001019541 | 112 | protein preY, mitochondrial precursor |
Identical Sequences to LMP013609 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66730545 | GenBank | AAH86361.1 | 112 | Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus] |
GI:66730545 | GenBank | EDL88035.1 | 112 | similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus] |
GI:66730545 | SwissProt | Q5U1Z8.1 | 112 | RecName: Full=Protein preY, mitochondrial; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013609 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66730545 | GenBank | AAH86361.1 | 112 | Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus] |
GI:66730545 | GenBank | EDL88035.1 | 112 | similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus] |
GI:66730545 | GenBank | EDL88036.1 | 161 | similar to RIKEN cDNA 2610022G08, isoform CRA_b [Rattus norvegicus] |
GI:66730545 | SwissProt | Q5U1Z8.1 | 112 | RecName: Full=Protein preY, mitochondrial; Flags: Precursor [Rattus norvegicus] |