Gene/Proteome Database (LMPD)

LMPD ID
LMP013610
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
angiopoietin-like 3
Gene Symbol
Alternate Names
angiopoietin-related protein 3;
Chromosome
5
Map Location
5q33

Proteins

angiopoietin-related protein 3 precursor
Refseq ID NP_001020236
Protein GI 68163569
UniProt ID Q5I0L8
mRNA ID NM_001025065
Length 322
MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGKVISLHHSLIC
sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1823 peptide sequence: MHTIKLLLFVVPLVIS

Gene Information

Entrez Gene ID
Gene Name
angiopoietin-like 3
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IEA:Ensembl C cell surface
GO:0005615 IEA:Ensembl C extracellular space
GO:0004859 IEA:Ensembl F phospholipase inhibitor activity
GO:0048844 IEA:Ensembl P artery morphogenesis
GO:0007160 IEA:Ensembl P cell-matrix adhesion
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0006631 IEA:Ensembl P fatty acid metabolic process
GO:0006071 IEA:Ensembl P glycerol metabolic process
GO:0019915 IEA:Ensembl P lipid storage
GO:0051005 IEA:Ensembl P negative regulation of lipoprotein lipase activity
GO:0010519 IEA:Ensembl P negative regulation of phospholipase activity
GO:0009395 IEA:Ensembl P phospholipid catabolic process
GO:0055091 IEA:Ensembl P phospholipid homeostasis
GO:0045766 IEA:Ensembl P positive regulation of angiogenesis
GO:0030335 IEA:Ensembl P positive regulation of cell migration
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0009725 IEP:RGD P response to hormone
GO:0007165 IEA:Ensembl P signal transduction
GO:0070328 IEA:Ensembl P triglyceride homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR002181 Fibrinogen, alpha/beta/gamma chain, C-terminal globular domain
IPR014716 Fibrinogen, alpha/beta/gamma chain, C-terminal globular, subdomain 1

UniProt Annotations

Entry Information

Gene Name
angiopoietin-like 3
Protein Entry
Q5I0L8_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013610 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
68163569 RefSeq NP_001020236 322 angiopoietin-related protein 3 precursor

Identical Sequences to LMP013610 proteins

Reference Database Accession Length Protein Name
GI:68163569 GenBank AAH88192.1 322 Angiopoietin-like 3 [Rattus norvegicus]

Related Sequences to LMP013610 proteins

Reference Database Accession Length Protein Name
GI:68163569 DBBJ BAE28956.1 455 unnamed protein product [Mus musculus]
GI:68163569 GenBank AAH88192.1 322 Angiopoietin-like 3 [Rattus norvegicus]
GI:68163569 GenBank EDL97807.1 455 angiopoietin-like 3, isoform CRA_b [Rattus norvegicus]
GI:68163569 RefSeq XP_006238502.1 455 PREDICTED: angiopoietin-related protein 3 isoform X1 [Rattus norvegicus]