Gene/Proteome Database (LMPD)
Proteins
angiopoietin-related protein 3 precursor | |
---|---|
Refseq ID | NP_001020236 |
Protein GI | 68163569 |
UniProt ID | Q5I0L8 |
mRNA ID | NM_001025065 |
Length | 322 |
MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGKVISLHHSLIC | |
sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1823 peptide sequence: MHTIKLLLFVVPLVIS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IEA:Ensembl | C | cell surface |
GO:0005615 | IEA:Ensembl | C | extracellular space |
GO:0004859 | IEA:Ensembl | F | phospholipase inhibitor activity |
GO:0048844 | IEA:Ensembl | P | artery morphogenesis |
GO:0007160 | IEA:Ensembl | P | cell-matrix adhesion |
GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0006631 | IEA:Ensembl | P | fatty acid metabolic process |
GO:0006071 | IEA:Ensembl | P | glycerol metabolic process |
GO:0019915 | IEA:Ensembl | P | lipid storage |
GO:0051005 | IEA:Ensembl | P | negative regulation of lipoprotein lipase activity |
GO:0010519 | IEA:Ensembl | P | negative regulation of phospholipase activity |
GO:0009395 | IEA:Ensembl | P | phospholipid catabolic process |
GO:0055091 | IEA:Ensembl | P | phospholipid homeostasis |
GO:0045766 | IEA:Ensembl | P | positive regulation of angiogenesis |
GO:0030335 | IEA:Ensembl | P | positive regulation of cell migration |
GO:0050996 | IEA:Ensembl | P | positive regulation of lipid catabolic process |
GO:0009725 | IEP:RGD | P | response to hormone |
GO:0007165 | IEA:Ensembl | P | signal transduction |
GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013610 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
68163569 | RefSeq | NP_001020236 | 322 | angiopoietin-related protein 3 precursor |
Identical Sequences to LMP013610 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68163569 | GenBank | AAH88192.1 | 322 | Angiopoietin-like 3 [Rattus norvegicus] |
Related Sequences to LMP013610 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68163569 | DBBJ | BAE28956.1 | 455 | unnamed protein product [Mus musculus] |
GI:68163569 | GenBank | AAH88192.1 | 322 | Angiopoietin-like 3 [Rattus norvegicus] |
GI:68163569 | GenBank | EDL97807.1 | 455 | angiopoietin-like 3, isoform CRA_b [Rattus norvegicus] |
GI:68163569 | RefSeq | XP_006238502.1 | 455 | PREDICTED: angiopoietin-related protein 3 isoform X1 [Rattus norvegicus] |