Gene/Proteome Database (LMPD)

LMPD ID
LMP013833
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Gene Symbol
Alternate Names
N-acylsphingosine amidohydrolase (acid ceramidase) 1;
Chromosome
8
Map Location
chromosome:8

Proteins

Refseq ID XP_001098342
Protein GI 109085733
UniProt ID F6S5C7
mRNA ID XM_001098342
Length 395
MLGRSRLSLVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGPAPWYTINLDLPPYKRWHELMADKAPMLKVIVNSLKNMVNTFVPSGKVMQIVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISYNIFYEFFTLCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSVNGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKNPFFLDDRRTPAKMCLNRTTQENISFENMYDVLSTKPVLNKLTVFTTLIDVTKDQFETYMRDCPDPCIGW
Refseq ID XP_001098236
Protein GI 109085735
UniProt ID F6S5F3
mRNA ID XM_001098342
Length 411
MNGRVWLGDKARGSHLASSPSLSALFTEASILGFGSSAVKAQWTEDCRKSTYPPSGPTYRGPAPWYTINLDLPPYKRWHELMADKAPMLKVIVNSLKNMVNTFVPSGKVMQIVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISYNIFYEFFTLCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSVNGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKNPFFLDDRRTPAKMCLNRTTQENISFENMYDVLSTKPVLNKLTVFTTLIDVTKDQFETYMRDCPDPCIGW

Gene Information

Entrez Gene ID
Gene Name
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005764 IEA:InterPro C lysosome
GO:0016811 IEA:InterPro F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0006629 IEA:InterPro P lipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04142 Lysosome
mcc04142 Lysosome
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis
mcc_M00099 Sphingosine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR029130 Acid ceramidase, N-terminal
IPR016699 Acid_ceramidase-like
IPR029132 Choloylglycine hydrolase/NAAA C-terminal
IPR003199 Choloylglycine hydrolase/Peptidase C59 family

UniProt Annotations

Entry Information

Gene Name
N-acylsphingosine amidohydrolase (acid ceramidase) 1
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013833 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109085735 RefSeq XP_001098236 411 N-acylsphingosine amidohydrolase (acid ceramidase) 1
109085733 RefSeq XP_001098342 395 N-acylsphingosine amidohydrolase (acid ceramidase) 1

Identical Sequences to LMP013833 proteins

Reference Database Accession Length Protein Name
GI:109085735 GenBank EHH28310.1 411 hypothetical protein EGK_18728 [Macaca mulatta]

Related Sequences to LMP013833 proteins

Reference Database Accession Length Protein Name
GI:109085735 DBBJ BAD51941.1 395 N-acylsphingosine amidohydrolase 1 [Macaca fascicularis]
GI:109085735 GenBank EHH64016.1 411 hypothetical protein EGM_17119 [Macaca fascicularis]
GI:109085735 GenBank AFE78316.1 395 acid ceramidase isoform a preproprotein [Macaca mulatta]
GI:109085735 SwissProt Q60HH4.1 395 RecName: Full=Acid ceramidase; Short=AC; Short=ACDase; Short=Acid CDase; AltName: Full=Acylsphingosine deacylase; AltName: Full=N-acylsphingosine amidohydrolase; Contains: RecName: Full=Acid ceramidase subunit alpha; Contains: RecName: Full=Acid ceramidase subunit beta; Flags: Precursor [Macaca fascicularis]