Gene/Proteome Database (LMPD)

LMPD ID
LMP014078
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fatty acid 2-hydroxylase
Gene Symbol
Alternate Names
fatty acid 2-hydroxylase;
Chromosome
20
Map Location
chromosome:20

Proteins

fatty acid 2-hydroxylase
Refseq ID NP_001181351
Protein GI 302564903
UniProt ID F7HMN1
mRNA ID NM_001194422
Length 372
Protein sequence is identical to GI:109129204 (mRNA isoform)
Refseq ID XP_001108607
Protein GI 109129204
UniProt ID F7HMN1
mRNA ID XM_001108607
Length 372
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEAVALEETQKTDPAMEPRFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLIPEKPHLKTQ

Gene Information

Entrez Gene ID
Gene Name
fatty acid 2-hydroxylase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0080132 IEA:Ensembl F fatty acid alpha-hydroxylase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0032286 IEA:Ensembl P central nervous system myelin maintenance
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0030258 IEA:Ensembl P lipid modification
GO:0032287 IEA:Ensembl P peripheral nervous system myelin maintenance
GO:0042127 IEA:Ensembl P regulation of cell proliferation
GO:0042634 IEA:Ensembl P regulation of hair cycle
GO:0001949 IEA:Ensembl P sebaceous gland cell differentiation
GO:0006665 IEA:InterPro P sphingolipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR018506 Cytochrome b5, heme-binding site
IPR001199 Cytochrome b5-like heme/steroid binding domain
IPR006694 Fatty_acid_hydroxylase
IPR014430 Inositolphosphorylceramide-B hydroxylase

UniProt Annotations

Entry Information

Gene Name
fatty acid 2-hydroxylase
Protein Entry
F7HMN1_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Contains 1 cytochrome b5 heme-binding domain.
Similarity Contains cytochrome b5 heme-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014078 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109129204 RefSeq XP_001108607 372 fatty acid 2-hydroxylase

Identical Sequences to LMP014078 proteins

Reference Database Accession Length Protein Name
GI:302564903 DBBJ BAE01931.1 372 unnamed protein product [Macaca fascicularis]
GI:302564903 RefSeq NP_001270612.1 372 fatty acid 2-hydroxylase [Macaca fascicularis]
GI:302564903 SwissProt Q4R4P4.1 372 RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Macaca fascicularis]

Related Sequences to LMP014078 proteins

Reference Database Accession Length Protein Name
GI:302564903 RefSeq XP_010381264.1 372 PREDICTED: fatty acid 2-hydroxylase [Rhinopithecus roxellana]